Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502108965

CPC Scientific H-Gly-Ser-Arg-Ala-His-Ser-Ser-His-Leu-Lys-Ser-Lys-Lys-Gly-Gln-Ser-Thr-Ser-Arg-His-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific CASP025A

Encompass

ONE-LETTER SEQUENCE: GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRGMOLECULAR FORMULA: C192H315N71O49S1MOLECULAR WEIGHT:4434.2STORAGE CONDITIONS: -20 5CRESEARCH AREA: ApoptosisREFERENCES: G. Selivanova, et al., Mol. Cell Biol. 19, 3395 (1999); G. Selivanova, et al., Nat. Med. 3, 632 (1997); G. Selivanova, et al., Nucleic Acids Res. 24, 3560 (1996)

Catalog No. 50-210-8965


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.