Learn More
CPC Scientific H-Gly-Ser-Arg-Ala-His-Ser-Ser-His-Leu-Lys-Ser-Lys-Lys-Gly-Gln-Ser-Thr-Ser-Arg-His-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific CASP025A
ONE-LETTER SEQUENCE: GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRGMOLECULAR FORMULA: C192H315N71O49S1MOLECULAR WEIGHT:4434.2STORAGE CONDITIONS: -20 5CRESEARCH AREA: ApoptosisREFERENCES: G. Selivanova, et al., Mol. Cell Biol. 19, 3395 (1999); G. Selivanova, et al., Nat. Med. 3, 632 (1997); G. Selivanova, et al., Nucleic Acids Res. 24, 3560 (1996)
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.