Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110058

CPC Scientific H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 (trifluoroacetate salt) 0.5MG
SDP

Supplier:  CPC Scientific PACA004A

Encompass

PACAP-38 and its N-terminal fragment PACAP-27 are novel neuropeptides originally isolated from bovine hypothalamus. They are also found in humans and rats. Both PACAP-27 and PACAP-38, showing considerable homology with vasoactive intestinal polypeptide (VIP), can stimulate adenylate cyclase much more potently than VIP.SEQUENCE: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 (trifluoroacetate salt)ONE-LETTER SEQUENCE: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2MOLECULAR FORMULA: C142H224N40O39S1MOLECULAR WEIGHT: 3147.65STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [127317-03-7]SYNONYMS: Pituitary Adenylate Cyclase Activating Polypeptide-27 (human, mouse, ovine, porcine, rat), PACAP-27 (human, mouse, ovine, porcine, rat)RESEARCH AREA: HormonalREFERENCES:A. Miyata et al., BBRC, 164, 567 (1989)A. Mirata et al., Regulatory Peptides, 26, 170 (1989)SKU(s): PACA-004A, PACA-004B

Catalog No. 50-211-0058


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.