Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Tocris Bioscience™ Parathyroid hormone (1-34) (rat)
GREENER_CHOICE

Catalog No. 63011
Change view
Click to view available options
Quantity:
1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
63-011 1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. 63-011 Supplier Tocris Bioscience™ Supplier No. 6301/1
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Parathyroid hormone (PTH) receptor agonist

Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats.

Specifications

Species Rat
Purity 95%
CAS 98614-76-7
Content And Storage Store at −20°C
For Use With (Application) Biological reactions
Molecular Weight (g/mol) 4057.74g/mol
Product Type Protein agonist
Quantity 1 mg
Regulatory Status RUO - research use only
Sequence AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.