Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 63011

Tocris Bioscience™ Parathyroid hormone (1-34) (rat)
GREENER_CHOICE

Catalog No. 63011
Click to view available options
Quantity:
1 mg
This item is not returnable. View return policy
This item is not returnable. View return policy

Description

Parathyroid hormone (PTH) receptor agonist

Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats.

Specifications

Species Rat
Purity 95%
CAS 98614-76-7
Content And Storage Store at −20°C
For Use With (Application) Biological reactions
Molecular Weight (g/mol) 4057.74g/mol
Product Type Protein agonist
Quantity 1 mg
Regulatory Status RUO - research use only
Sequence AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.