Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPC Scientific H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH 0.5MG
SDP

Supplier:  CPC Scientific PTHP002A

Encompass

SEQUENCE: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OHONE-LETTER SEQUENCE: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFMOLECULAR FORMULA: C181H291N55O51S2MOLECULAR WEIGHT: 4117.77STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [52232-67-4]SYNONYMS: pTH (1-34) (human), TeriparatideRESEARCH AREA: OsteoporosisREFERENCES:T. Takai et al., Peptide Chemistry, 1978, 187 (1979)G.W. Tregear et al., Hoppe-Seyler's Z. Physiol. Chem., 355, 415 (1974)

SKU(s): PTHP-002A, PTHP-002B, PTHP-002C

Catalog No. 50-211-0334


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.