Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Medchemexpress LLC Pardaxin P5 TFA | 67995-63-5 | ≥98% | 3381.87 | 1 MG
SDP

Catalog No. 5000397132
Encompass_Preferred

Pardaxin P5 TFA is the trifluoroacetate salt form of Pardaxin P5. This antimicrobial peptide is known to inhibit Escherichia coli with a MIC value of 13 μM, making it suitable for anti-infection research.

  • Antimicrobial peptide
  • Inhibits Escherichia coli with a MIC value of 13 μM
  • TFA salt form of Pardaxin P5
  • Supplied as a solid
  • Specific peptide sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
  • Soluble in DMSO (100 mg/mL, requires ultrasonic)
  • Targets bacterial organisms and anti-infection pathways

Catalog No. 50-003-97132 Supplier Medchemexpress LLC Supplier No. HYP5803A1MG
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

Pardaxin P5 TFA is the trifluoroacetate salt form of Pardaxin P5. This antimicrobial peptide is known to inhibit Escherichia coli with a MIC value of 13 μM, making it suitable for anti-infection research.

  • Antimicrobial peptide
  • Inhibits Escherichia coli with a MIC value of 13 μM
  • TFA salt form of Pardaxin P5
  • Supplied as a solid
  • Specific peptide sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
  • Soluble in DMSO (100 mg/mL, requires ultrasonic)
  • Targets bacterial organisms and anti-infection pathways

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.