Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502011315

Enzo Life Sciences PDKtide (biotinylated) (100µg)
SDP

Supplier:  Enzo Life Sciences BMLP2510100

Encompass_Preferred

This peptide, Biotin-Ahx-KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, is derived from AKT1 and PKN2/PRK2. It is a substrate for PDK1, CDK9/Cyclin T1 and JAK2.The biotin allows peptide to be used in kinase assays with streptavidin-bound membranes. Purity: ≥95%. Long Term Storage: -20°C.

Catalog No. 50-201-1315


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.