Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Enzo Life Sciences Peptide tyrosine tyrosine polyclonal antibody (100µl)
SDP

Supplier:  Enzo Life Sciences BMLPA12540100

Encompass_Preferred

Immunogen: Natural pig PYY (peptide with tyrosine; HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.). Source: Whole rabbit serum. Species reactivity: Species independent. Specificity: Recognizes PYY in a wide range of species. Applications: IHC, WB. Formulation: Liquid. Antiserum containing 10mM sodium azide.

Catalog No. 50-201-1369


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.