Learn More
Novus Biologicals™ PNMA6A Recombinant Protein Antigen

Description
Specifications
Specifications
| Protein Length | IPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVN |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | PNMA6A Recombinant Protein Antigen |
| Content And Storage | Store at −20°C short term. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4 |
| For Use With (Application) | AC |
| Gene Alias | MA6, MGC15827, paraneoplastic antigen like 6A, PNMA6 |
| Gene Symbol | PNMA6A |
| Label Type | Unlabeled |
| Molecular Weight (g/mol) | 26 kDa |
| Show More |
For Research Use Only.
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.