Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 50894298

BioVendor, LLC PROTEIN Cystatin C Human E. coli, 0.1 MG
SDP

Supplier:  BioVendor, LLC RD172009100H

Encompass

Type Recombinant protein Description Total 129 AA. Mw: 14.5 kDa (calculated). UniProtKB acc.no. P01034. N-terminal His-tag, 9 extra AA (highlighted). Amino Acid Sequence MKHHHHHHASSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Source E. coli Purity Purity as determined by densitometric image analysis: >95% Endotoxin < 0.1 EU/μg Applications Western blotting, ELISA

Catalog No. 50-894-298


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.