Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Rat Igf1 Recombinant Protein
Used for Func, SDS-PAGE
Supplier: Abnova™ P4840
Description
Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSASpecifications
P08025 | |
Lyophilized | |
7.7kDa | |
Escherichia coli expression system | |
50 ug | |
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. | |
<0.1 EU/μg | |
Igf1 | |
E. coli | |
None | |
Lyophilized |
Functional Study, SDS-PAGE | |
24482 | |
Igf1 (Rat) Recombinant Protein | |
1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue | |
GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA | |
RUO | |
Igf1 | |
The activity is determined by the dose dependent proliferation of FDC-P1 cells. The expected ED50 for this effect is 61-91ng/mL. | |
Recombinant | |
Escherichia coli expression system |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction