Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ RBM28 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier: Novus Biologicals™ NBP184632PEP

Catalog No. NBP184632PE

$337.00 / Each of 1

Qty

Add to Cart

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBM28. The RBM28 Recombinant Protein Antigen is derived from E. coli. The RBM28 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez)	55131
Purification Method	Chromatography
Concentration	0.5mg/mL
Formulation	PBS and 1M Urea, pH 7.4.
Gene Symbol	RBM28
Molecular Weight (g/mol)	31kDa
Quantity	0.1mL
Source	E.Coli
Immunogen	RKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQSLGYAFAEFQEHEHALKALRLINNNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQRSLQKMRSKPATGEPQKGQPEPAKDQQQK

Species	Human
Purity	>80%
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application)	Blocking/Neutralizing, Control
Label Type	Unlabeled
Product Type	RBM28
Regulatory Status	RUO
Specific Reactivity	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84632. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Product Suggestions Safety and Handling

Safety and Handling

ShelfLife : 365

Provide Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Full Name

Email Address *

User Name

What type of issue did you experience with the content on the page? *

Please provide a detailed description of the issue or request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only

Spot an opportunity for improvement?

Provide Content Correction

Novus Biologicals™ RBM28 Recombinant Protein Antigen

Description

Specifications

Product Suggestions

Safety and Handling

Documents

Promotions