Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ S100A7 Recombinant Protein

Catalog No. 89010629 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-010-629 10 μg
89-010-630 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-010-629 Supplier Abnova™ Supplier No. H00006278P0110
Only null left
Add to Cart
Add to Cart

Human S100A7 full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known.

  • Theoretical MW (kDa): 36.85
  • Preparation Method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number AAH34687.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 6278
Molecular Weight (g/mol) 36.85
Name S100A7 (Human) Recombinant Protein (P01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Source Wheat Germ (in vitro)
Immunogen MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias PSOR1/S100A7c
Common Name S100A7
Gene Symbol S100A7
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.