Novus Biologicals™ Six3 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP257249PEP

Catalog No. NBP257249PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Six3. Source: E.coli Amino Acid Sequence: KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDS The Six3 Recombinant Protein Antigen is derived from E. coli. The Six3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 6496
• Common Name: Six3 Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: holoprosencephaly 2, alobar or semilobar, homeobox protein SIX3, HPE2, Sine oculis homeobox homolog 3, sine oculis homeobox homolog 3 (Drosophila), SIX homeobox 3
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: SIX3
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53070. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.