Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 5000424841

Medchemexpress LLC SjDX5-271 | 2767993-76-8 | 98.9% | 3336.52 | 1 MG
SDP

Supplier:  Medchemexpress LLC HYP108971MG

Encompass_Preferred

SjDX5-271 is a small 3 kDa peptide. It inhibits the TLR4/MyD88/NF-κB signaling pathway, induces cell polarization, alleviates hepatic inflammation, and protects mice against liver ischemia-reperfusion injury.

  • Inhibits TLR4/MyD88/NF-κB signaling pathway
  • Induces cell polarization
  • Alleviates hepatic inflammation
  • Protects mice against liver ischemia-reperfusion injury
  • Target: TLR4
  • Appearance: Solid, white to off-white
  • Sequence: YKNLGGQQQSGSSQGQFPSGQMQQQQRPQQ
  • Related classifications: Peptides, inflammation or immune system disease, blood or cardio-cerebrovascular disease, immunology/inflammation, NF-κB, Toll-like receptor (TLR)

Catalog No. 50-004-24841


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.