Novus Biologicals™ SOX13 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOX13. Source: E.coli Amino Acid Sequence: DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT The SOX13 Recombinant Protein Antigen is derived from E. coli. The SOX13 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 9580
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: SOX13 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: Islet cell antigen 12, MGC117216, Sox-13, SRY (sex determining region Y)-box 13ICA12islet cell 12, SRY-box 13, SRY-related HMG-box gene 13, transcription factor SOX-13, Type 1 diabetes autoantigen ICA12
• Gene Symbol: SOX13
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50211. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.