Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NB170652

Novus Biologicals™ SPAM1 Synthetic Peptide
SDP

Catalog No. NB170652 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB170652 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. NB170652 Supplier Novus Biologicals™ Supplier No. NBP283580PEP
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

55kDa synthetic peptide

located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP (Uniprot: P38567)

Specifications

Gene ID (Entrez) 6677
Purity Multi-step
Concentration LYOPH
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application) This peptide is useful as a blocking peptide for NBP2-83580. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochemistry under proper experimental settings.
Gene Alias EC 3.2.1.35, HYA1, HYAL1, HYAL3, HYAL5, Hyal-PH20, hyaluronidase PH-20, Hyaluronoglucosaminidase PH-20, MGC26532, PH20, PH-20, SPAG15, Sperm adhesion molecule 1, sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding), Sperm surface protein PH-20
Gene Symbol SPAM1
Molecular Weight (g/mol) M.W. Theoretical: 55 kDa
Quantity 100 μg
Research Category Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.