Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 5000397337

Medchemexpress LLC Stieeqaktfldkfnheaedlfyqsslaswn | 95.3% | 3649.88 | 10 MG
SDP

Catalog No. 5000397337
Encompass_Preferred

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN is an angiotensin-converting enzyme 2 (ACE2) related peptide. It is used to study the function of ACE2 and has a molecular weight of 3649.88 with a chemical formula of C164H238N40O55. It appears as a white to off-white solid and is intended for research use only, not for human use.

  • Angiotensin-converting enzyme 2 (ACE2) related peptide
  • Used to study the function of ACE2
  • Molecular weight of 3649.88
  • White to off-white solid appearance
  • For research use only

Catalog No. 50-003-97337 Supplier Medchemexpress LLC Supplier No. HYP314110MG
May include imposed supplier surcharges.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN is an angiotensin-converting enzyme 2 (ACE2) related peptide. It is used to study the function of ACE2 and has a molecular weight of 3649.88 with a chemical formula of C164H238N40O55. It appears as a white to off-white solid and is intended for research use only, not for human use.

  • Angiotensin-converting enzyme 2 (ACE2) related peptide
  • Used to study the function of ACE2
  • Molecular weight of 3649.88
  • White to off-white solid appearance
  • For research use only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.