Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.1MG
Supplier: CPC Scientific AMYD012A
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?