Learn More
CPC Scientific H-Asp-Val-Thr-Ala-Pro-Leu-Val-Asp-Glu-Gly-Ala-Pro-Gly-Lys-Gln-Ala-Ala-Ala-Gln-Pro-His-Thr-Glu-Ile-Pro-Glu-Gly-Thr-Thr-OH (trifluoroacetate salt) 1MG

Supplier: CPC Scientific TAUP002A
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer?s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus (see figure below). Tau Peptide (74-102) is a 29-amino acid long peptide derived from the Exon 3/Insert 2 domain.ONE-LETTER SEQUENCE: DVTAPLVDEGAPGKQAAAQPHTEIPEGTTMOLECULAR FORMULA: C124H198N34O46MOLECULAR WEIGHT:2901.14STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1322695-34-0], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: Buee, L. et al. Brain Res Rev 33 95 (2000). Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.