Learn More
Carbosynth LLC. Teduglutide, 5mg, Bolar Exemption applies.

Supplier: Carbosynth LLC. TED3880PI5MG
Synonyms: H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH, [Gly2]-GLP-2 (human) , HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, Application: Glucagon-like Peptide-2 Analog Used to Treat Short Bowel Syndrome , Salt Form:, Trifluoroacetate , Storage Temperature: -20 °C, References: Jeppesen, P., et al.: Gut, 54, 1224 (2005)., Jeppesen, P.B., Therap. Adv. Gastroenterol., 5,159 (2012)., D. J. Drucker et al., American Journal of Physiology - Gastrointestinal and Liver Physiology, 276(1), G79 (1999).
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.