Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Carbosynth LLC. Teduglutide, 5mg, Bolar Exemption applies.
SDP

Supplier:  Carbosynth LLC. TED3880PI5MG

Encompass_Preferred

Synonyms: H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH, [Gly2]-GLP-2 (human) , HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, Application: Glucagon-like Peptide-2 Analog Used to Treat Short Bowel Syndrome , Salt Form:, Trifluoroacetate , Storage Temperature: -20 °C, References: Jeppesen, P., et al.: Gut, 54, 1224 (2005)., Jeppesen, P.B., Therap. Adv. Gastroenterol., 5,159 (2012)., D. J. Drucker et al., American Journal of Physiology - Gastrointestinal and Liver Physiology, 276(1), G79 (1999).

Catalog No. 50-168-7199


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.