Novus Biologicals™ TRPM2 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPM2. Source: E.coli Amino Acid Sequence: IKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQK The TRPM2 Recombinant Protein Antigen is derived from E. coli. The TRPM2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 7226
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: TRPM2 Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: EC 3.6.1.13, EREG1MGC133383, Estrogen-responsive element-associated gene 1 protein, KNP3LTrpC-2, Long transient receptor potential channel 2, LTrpC2, LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2, NUDT9H, NUDT9L1, transient r
• Gene Symbol: TRPM2
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51204. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only