Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109863

CPC Scientific H-Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Leu-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific NATR012B

Encompass

ONE-LETTER SEQUENCE: YSPKMVQGSGCFGRKMDRLSSSSGLGCKVLRRH (Cys11 and 27 bridge)MOLECULAR FORMULA: C152H253N51O44S4MOLECULAR WEIGHT:3627.26STORAGE CONDITIONS: -20 5CSYNONYMS: (Tyr0)-Brain Natriuretic Peptide-32 (human), ventricular natriuretic peptide, (Tyr)-BNP-32 (human)RESEARCH AREA: Cardiovascular

Catalog No. 50-210-9863


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.