Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502109150

CPC Scientific H-Tyr-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-OH (acetate salt) 1MG
SDP

Supplier:  CPC Scientific CPEP002B

Encompass

ONE-LETTER SEQUENCE: YEAEDLQVGQVELGGGPGAGSLQPLALEGSLQMOLECULAR FORMULA: C138H220N36O50MOLECULAR WEIGHT:3183.5STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [57327-90-9], RESEARCH AREA: DiabetesREFERENCES: V.K. Naithani et al., Hoppe Seylers Z. Physiol. Chem., 356, 1305 (1975); N. Yanaihara et al., Hoppe Seylers Z. Physiol. Chem., 362, 775 (1981); H. Sun et al., Appl. Biochem. Biotechnol., 55, 167 (1995)

Catalog No. 50-210-9150


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.