Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110034

CPC Scientific H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (trifluoroacetate salt) 1MG
SDP

Supplier:  CPC Scientific OSTP019B

Encompass

Calcitonin gene related peptide (CGRP) is part of the calcitonin family of peptides, which in humans exists in two forms, alpha-CGRP and beta-CGRP. alpha-CGRP is a 37-amino acid peptide formed from the alternative genetic splicing of the calcitonin/CGRP geneONE-LETTER SEQUENCE: YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Cys3 and 8 bridge)MOLECULAR FORMULA: C172H276N52O51S2MOLECULAR WEIGHT:3952.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [124756-98-5], SYNONYMS: Tyr-alpha-CGRP (human), Tyr-CGRP I (human)RESEARCH AREA: CardiovascularREFERENCES: J Biol Chem. 2006 Mar 17, 281(11):7205-13

Catalog No. 50-211-0034


May include imposed supplier surcharges.
Add to Cart

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.