Novus Biologicals™ VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VDR/NR1I1/Vitamin D Receptor. Source: E.coli Amino Acid Sequence: DAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDP The VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen is derived from E. coli. The VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 7421
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: NR1I1Nuclear receptor subfamily 1 group I member 11,25-dihydroxyvitamin D3 receptor, vitamin D1,25- dihydroxyvitamin D3 receptor, vitamin D3 receptor
• Gene Symbol: VDR
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51538. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only