Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. 502110608

CPC Scientific H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 1MG
SDP

Supplier:  CPC Scientific VIP001B

Encompass

A 28 amino acid peptide synthesized in the central nervous system and gastrointestinal tract. It belongs to the secretin glucagon-CRF family and is widely distributed in the central and peripheral nervous systems. In acting as both a neurotransmitter and hormone that has powerful hypotensive and vasodilatory effects, this peptide plays a wide role in a range of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretin. When paired with the adrenegic drug phentolamine and injected, this peptide is expected to provide a new and effective solution for patients suffering from erectile dysfunction.SEQUENCE: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2ONE-LETTER SEQUENCE: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2MOLECULAR FORMULA: C147H238N44O42S1MOLECULAR WEIGHT: 3325.80STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [40077-57-4]SYNONYMS: Aviptadil, VIP (

Catalog No. 50-211-0608


May include imposed supplier surcharges.
Only null left
Add to Cart

Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.