Learn More
CPC Scientific H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 1MG

Supplier: CPC Scientific VIP001B
A 28 amino acid peptide synthesized in the central nervous system and gastrointestinal tract. It belongs to the secretin glucagon-CRF family and is widely distributed in the central and peripheral nervous systems. In acting as both a neurotransmitter and hormone that has powerful hypotensive and vasodilatory effects, this peptide plays a wide role in a range of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretin. When paired with the adrenegic drug phentolamine and injected, this peptide is expected to provide a new and effective solution for patients suffering from erectile dysfunction.SEQUENCE: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2ONE-LETTER SEQUENCE: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2MOLECULAR FORMULA: C147H238N44O42S1MOLECULAR WEIGHT: 3325.80STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [40077-57-4]SYNONYMS: Aviptadil, VIP (
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.