Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP238156PE

Novus Biologicals™ ZNF710 Recombinant Protein Antigen
SDP

Numéro de catalogue. NBP238156PE
Modifier l'affichage
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
NBP238156PE 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. NBP238156PE Fournisseur Novus Biologicals™ Code fournisseur NBP238156PEP

Customers require a valid business account associated to their profile to access pricing and ordering options.

Pour de l'aide SVP utiliser la function de clavardage; nous envoyer un couriel à help@thermofisher.com ou appelez le service à la clientèle au 1-800-234-7437.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF710. The ZNF710 Recombinant Protein Antigen is derived from E. coli. The ZNF710 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38156. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Spécifications

Gene ID (Entrez) 374655
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol ZNF710
Label Type Unlabeled
Molecular Weight (g/mol) 25kDa
Product Type ZNF710
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38156. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen KVKFEKVEEEEQEVYEVSVPGDDKDAGPAEAPAEAASGGCDALVQSSAVKMIDLSAFSRKPRTLRHLPRTP
Afficher plus de résultats Afficher moins de résultats

For Research Use Only

missing translation for 'productTitle'
missing translation for 'pleaseSelectIssue'

missing translation for 'byClickingSubmit' missing translation for 'privacyPolicy'.