Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

1,951 – 1,965 of 119,734 results

1,951

Novus Biologicals MAdCAM-1 Recombinant Protein Antigen

Pricing & Availability

1,952

Promotions Available

R&D Systems™ Recombinant Human CD37 Fc Chimera Protein

Measured by its binding ability in a functional ELISA.

Pricing & Availability

1,953

MilliporeSigma™ Human G-CSF Recombinant Protein, Animal Free

Pricing & Availability

1,954

Promotions Available

R&D Systems™ Recombinant Mouse IL-18/IL-1F4 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie Blue Staining.
Conjugate	Unconjugated
Molecular Weight (g/mol)	18 kDa
Endotoxin Concentration	<0.10 EU per 1μg of protein by LAL method
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Source	E. coli-derived mouse IL-18/IL-1F4 protein Asn36-Ser192
Name	Iboctadekin, IFN-gamma-inducing factor, IGIF, IGIFIL-1 gamma, IL18, IL-18MGC12320, IL-1F4, IL1F4iboctadekin, IL-1g, Interferon gamma-inducing factor, interleukin 18 (interferon-gamma-inducing factor), Interleukin-1 gamma, interleukin-18
Accession Number	P70380
Regulatory Status	RUO
Biological Activity	Measured by its ability to induce mouse IFN-gamma secretion by activated mouse T cells. The ED50 for this effect is typically 0.06-0.36 ng/mL.
Gene ID (Entrez)	3606
Formulation	Lyophilized from a 0.2μm filtered solution in PBS, EDTA and DTT with trehalose.
Species	Mouse
Recombinant	Recombinant

1,955

Novus Biologicals™ OBSCN Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

1,956

Novus Biologicals™ Recombinant Human IDI1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

1,957

R&D Systems™ Recombinant Mouse Tryptase beta-1/Mcpt7 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

Pricing & Availability

1,958

Novus Biologicals™ Recombinant Human ZNHIT3 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

1,959

R&D Systems™ Recombinant Human DLL4 His-tag Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

1,960

R&D Systems™ Recombinant Mouse Noggin (aa 28-232) Protein

Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.04 to 0.16 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4.

Pricing & Availability

1,961

R&D Systems™ Recombinant Chicken Netrin-1 Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	66.3 kDa
Gene ID (Entrez)	396389
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Mouse myeloma cell line,NS0-derived chicken Netrin-1 protein, (N-terminus) Chicken Netrin-1 (Gly26-Ala606) Accession &Num; Q90922 DIEGRGGGSGGGSGGGS 10-His tag (C-terminus)
Recombinant	Recombinant
Name	Netrin-1

1,962

Promotions Available

R&D Systems™ Recombinant Rabbit IL-21 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Accession Number	XP_008266193
Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	15.5 kDa
Gene ID (Entrez)	100344172
Quantity	25 μg
Structural Form	Monomer
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Recombinant	Recombinant
Name	IL-21

1,963

BD H-2Ld:Ig Recombinant Soluble Dimeric Fusion Protein, Mouse

Consists of three extracellular major histocompatibility complex (MHC) class I H-2Ld domains that are fused to the VH regions of mouse IgG1, supplemented with recombinant β2M

Pricing & Availability

1,964

Novus Biologicals™ ANP32A Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	ANP32A
Molecular Weight (g/mol)	30.7kDa
Gene ID (Entrez)	8125
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl, 0.1mM PMSF
Immunogen	ANP32A, 1-249aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

1,965

Promotions Available

R&D Systems™ Recombinant Mouse MIF Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	12.4 kDa
Gene ID (Entrez)	17319
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived mouse MIF protein Pro2-Ala115
Recombinant	Recombinant
Name	MIF

Prev
1
...
129
130
131
132
...
7,983
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals MAdCAM-1 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Mouse IL-18/IL-1F4 Protein GSA/VA ContractAvailable on GSA/VA contract for Federal Government customers.Learn More

Novus Biologicals™ OBSCN Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human IDI1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ZNHIT3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ANP32A Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals MAdCAM-1 Recombinant Protein Antigen

R&D Systems™ Recombinant Mouse IL-18/IL-1F4 Protein

Novus Biologicals™ OBSCN Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human IDI1 His Protein

Novus Biologicals™ Recombinant Human ZNHIT3 His Protein

Novus Biologicals™ ANP32A Protein