Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

211 – 225 of 108,475 results

211

Invitrogen™ Human CHEK1 (CHK1), His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	Chk1
Molecular Weight (g/mol)	58.1 kDa
KinaseFamily	CAMKL Kinase Family
Gene Symbol	Chek1
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human CHEK1 (CHK1), His Tag
Accession Number	O14757
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	C85740; Cell cycle checkpoint kinase; checkpoint kinase 1; checkpoint kinase 1 homolog; checkpoint kinase-1; Checkpoint, S. pombe, homolog of, 1; CHEK1; CHK1; CHK1 checkpoint homolog; Chk1-S; homolog of Chk1-S; HRD1 Protein; rad27; rad27 homolog; serine/threonine protein kinase CHK1; serine/threonine-protein kinase Chk1; Synoviolin; YBR1742; YBR274W
Product Type	Protein
Gene ID (Entrez)	1111
Formulation	50mM tris with 1mM DTT, 50% glycerol, 250mM NaCl, 0.05% NP-40, 0.05mM EDTA and no preservative; pH 7.5
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

212

Invitrogen™ Human EIF2AK2 (PKR), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	PKR
Molecular Weight (g/mol)	62.2 kDa
KinaseFamily	PEK Kinase Family
Gene Symbol	EIF2AK2
Sequence	252-551
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human EIF2AK2 (PKR), GST Tag
Accession Number	P19525
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	2310047A08Rik; 4732414G15Rik; AI467567; AI747578; double stranded RNA activated protein kinase; dsRNA-activated kinase; EC 2.7.11.1; eIF-2 alpha; eIF2a Kinase; eIF-2A protein kinase 2; EIF2AK1; EIF2AK2; eukaryotic translation initiation factor 2 alpha kinase 2; eukaryotic translation initiation factor 2-alpha kinase 2; IFN- type I-induced and dsRNA-activated kinase; IFN-induced and double-stranded RNA-activated kinase; interferon-induced, double-stranded RNA-activated protein kinase; interferon-inducible elF2alpha kinase; interferon-inducible RNA-dependent protein kinase; MGC126524; OTTHUMP00000201320; P1/eIF-2A protein kinase; p68 kinase; PKR; PPP1R83; Prkr; protein kinase R; protein kinase RNA-activated; protein kinase, interferon inducible double stranded RNA dependent; Protein kinase, interferon-inducible double stranded RNA dependent; protein phosphatase 1, regulatory subunit 83; serine/threonine-protein kinase TIK; T-cell viral integration site; Tik; Tyrosine-protein kinase EIF2AK2
Product Type	Protein
Gene ID (Entrez)	5610
Formulation	50mM tris with 2mM DTT, 50% glycerol, 0.5mM EDTA, 150mM NaCl, 0.02% Triton X-100 and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

213

Invitrogen™ Human PRKCG (PKC gamma), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
pH Range	8
Common Name	PKC gamma
Molecular Weight (g/mol)	112.3 kDa
KinaseFamily	PKC Kinase Family
Gene Symbol	PRKCG
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human PRKCG (PKC gamma), GST Tag
Accession Number	P05129
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	PKC; Pkcc; PKCG; PKCgamma; PKC-gamma; PKCI; Prkc; Prkcc; PRKCG; protein kinase C gamma; protein kinase C gamma type; protein kinase C type I (gamma type); protein kinase C, gamma; RATPKCI; SCA14
Product Type	Protein
Gene ID (Entrez)	5582
Formulation	50mM tris HCl with 20% glycerol, 100mM NaCl, 15mM glutathione, 5mM DTT and no preservative; pH 8
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

214

Invitrogen™ Human TEX264 (aa 107-184) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
Form	Liquid
Formulation	1 M urea, PBS with no preservative; pH 7.4
Sequence	PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL
Concentration	≥5.0 mg/mL
For Use With (Application)	Blocking Assay,Control
Name	Human TEX264 (aa 107-184) Control Fragment
Recombinant	Recombinant

215

Invitrogen™ Human EphA2, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	For research use only. Not for use in diagnostic procedures
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	76.7 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human EphA2, GST Tag
Recombinant	Recombinant

216

Invitrogen™ Human MINK1, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	For research use only. Not for use in diagnostic procedures
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	63.9 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human MINK1, GST Tag
Recombinant	Recombinant

217

Invitrogen™ Human RET, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	RET
Molecular Weight (g/mol)	79 kDa
KinaseFamily	RET Kinase Family
Gene Symbol	RET
Kinase Group	Tyrosine Kinases
Sequence	658-1114
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human RET, GST Tag
Accession Number	P07949
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Cadherin family member 12; Cadherin family member 12 (CDHF12); Cadherin related family member 16 (CDHR16); cadherin-related family member 16; CDHF12; CDHR16; CG1061; CG14396; CG14396-PA; CG14396-PB; CG14396-PC; c-Ret; CUX1/RET fusion; Dmel\CG14396; Dmel_CG14396; DmHD-59; DmRet; Dret; D-ret; EC 2.7.10.1; ELKS; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment; HD-59; HSCR1; Hydroxyaryl protein kinase; hydroxyaryl-protein kinase; kinase Ret; MEN2; MEN2A; MEN2B; MTC1; Multiple endocrine neoplasia and medullary thyroid carcinoma 1; Oncogene RET; OTTHUMP00000216967; proto-oncogene c-Ret; Proto-oncogene tyrosine-protein kinase receptor Ret; PTC; rearranged during transfection; receptor tyrosine kinase; ret; RET ELE1; Ret gene for receptor tyrosin; Ret oncogene; ret proto-oncogene; ret proto-oncogene (multiple endocrine neoplasia and medullary thyroid carcinoma 1, Hirschsprung disease); Ret proto-oncogene (multiple endocrine neoplasia MEN2A MEN2B and medullary thyroid carcinoma 1 Hirschsprung disease); RET receptor tyrosine kinase; RET transforming sequence; RET51; RET9; RET-ELE1; Reto; Ret-PA; Ret-PB; Ret-PC; Soluble RET kinase fragment
Product Type	Protein
Gene ID (Entrez)	5979
Formulation	50mM tris HCl with 2mM DTT, 150mM NaCl, 50% glycerol, 0.5mM EDTA, 0.02% Triton X-100 and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

218

Invitrogen™ Human ERN1, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	IRE1 alpha
Molecular Weight (g/mol)	84.1 kDa
KinaseFamily	IRE Family
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human ERN1, GST Tag
Purification Method	Purified
Gene Alias	9030414B18Rik; AI225830; C85377; endoplasmic reticulum (ER) to nucleus signalling 1; endoplasmic reticulum to nucleus signaling 1; endoplasmic reticulum to nucleus signalling 1; endoplasmic reticulum-to-nucleus signaling 1; Endoribonuclease; ER to nucleus signalling 1; ERN1; FLJ30999; hIRE1p; inositol-requiring 1; inositol-requiring 1 alpha; inositol-requiring enzyme 1; inositol-requiring protein 1; IRE1; IRE1a; IRE1a antibody; Ire1alpha; Ire1-alpha; Ire1p; IRE1p antibody; MGC163277; MGC163279; protein kinase/endoribonuclease; RGD1559716; Serine/threonine-protein kinase; Serine/threonine-protein kinase/endoribonuclease IRE1; serine/threonine-protein kinase/endoribonuclease IRE1-like
Protein Form	Recombinant, Active, Catalytic
Formulation	50mM tris HCl with 25% glycerol, 10mM glutathione, 150mM NaCl, 0.1mM PMSF, 0.25mM DTT, 0.1mM EDTA and no preservative; pH 7.5
Species	Human
Recombinant	Recombinant
Shipping Condition	Dry Ice
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Gene Symbol	ERN1
Sequence	468-end
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Accession Number	O75460
Regulatory Status	RUO
Product Type	Protein
Protein Length	468-end
Gene ID (Entrez)	2081
Protein Tag	GST-tag

219

Invitrogen™ Human MYO3B (MYO3 beta), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	MYO3B
Molecular Weight (g/mol)	63.3 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human MYO3B (MYO3 beta), GST Tag
Accession Number	Q8WXR4
Gene Alias	A430065P19Rik; MYO3B; myosin IIIB; myosin IIIB1; myosin IIIB2; myosin-IIIb; RGD1560313
Protein Length	1-362
Gene ID (Entrez)	140469
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM EGTA, 0.1 mM PMSF, 0.25 mM DTT, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

220

Invitrogen™ Human AMPK alpha-1/beta-2/gamma-1, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	AMPK alpha-1/beta-2/gamma-1
Molecular Weight (g/mol)	63.6-36-40 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human AMPK alpha-1/beta-2/gamma-1, His Tag
Protein Length	10-end
Formulation	50 mM sodium phosphate with 0.1 mM PMSF, 0.2 mM DTT, 150 mM Imidazole, 25% glycerol, 300 mM NaCl and no preservative; pH 7
Protein Tag	His-tag
Species	Human
Recombinant	Recombinant

221

Invitrogen™ Human CASK, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	CASK
Molecular Weight (g/mol)	91 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human CASK, GST Tag
Accession Number	O14936
Gene Alias	CAGH39; calcium/calmodulin dependent serine protein kinase; calcium/calmodulin-dependent serin protein kinase; Calcium/calmodulin-dependent serine protein kinase; calcium/calmodulin-dependent serine protein kinase (MAGUK family); calcium/calmodulin-dependent serine protein kinase membrane-associated guanylate kinase; CAMGUK; CASK; CMG; DXPri1; DXRib1; FGS4; G-protein-coupled receptor GPR34; hCASK; LIN2; LIN-2; MGC7449; MICPCH; mLin-2; MRXSNA; OTTHUMP00000023157; OTTHUMP00000023161; OTTHUMP00000023162; Pals3; peripheral plasma membrane protein CASK; Protein lin-2 homolog; RP23-278L4.1; TNRC8; trinucleotide repeat containing 8
Protein Length	1-570
Gene ID (Entrez)	8573
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

222

Invitrogen™ Human AMPK A2/B1/G1, GST Tag, His Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Shipping Condition	Dry Ice
Conjugate	Unconjugated
Form	Liquid
pH Range	7.5
Common Name	AMPK alpha-2/beta-1/gamma-1
Molecular Weight (g/mol)	91.4-57.8-41.7 kDa
KinaseFamily	CAMKL Kinase Family
Gene Symbol	PRKAA2, PRKAB1, PRKAG1
Sequence	Full length
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human AMPK A2/B1/G1, GST Tag, His Tag
Accession Number	P54619, P54646, Q9Y478
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	AMPK alpha 2/beta 1/gamma 1; AMPK alpha2/beta1/gamma1
Product Type	Protein
Gene ID (Entrez)	5563, 5564, 5571
Formulation	50mM tris with 2mM DTT, 50% glycerol, 0.5mM EDTA, 150mM NaCl, 0.02% Triton X-100 and no preservative; pH 7.5
Protein Tag	GST-tag, His-tag
Species	Human
Recombinant	Recombinant

223

Invitrogen™ Human JAK2 [V617F], JH1 and JH2 Domains, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	For research use only. Not for use in diagnostic procedures
Conjugate	Unconjugated
Form	Liquid
Molecular Weight (g/mol)	97.9 kDa
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Concentration	See Label
For Use With (Application)	Kinase Assay
Name	Human JAK2 [V617F], JH1 and JH2 Domains, GST Tag
Recombinant	Recombinant

224

Invitrogen™ Human EEF2K, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	EEF2K
Molecular Weight (g/mol)	109.9 kDa
KinaseFamily	Alpha Kinase Family
Sequence	Full length
Concentration	See Label
Expression System	E. coli
For Use With (Application)	Kinase Assay
Name	Human EEF2K, GST Tag
Accession Number	O00418
Regulatory Status	RUO - research use only
Gene Alias	C86191; Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase; calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase; calmodulin-dependent protein kinase III; EC 2.7.11.20; eEF-2 kinase; Eef2k; eEF-2 K; EF2K; elongation factor 2 kinase; elongation factor-2 kinase; euk; eukaroytic elongation factor 2 kinase; eukaryotic elongation factor 2 kinase; eukaryotic elongation factor-2 kinase; HSU93850; kinase eEF2K; SMEF2K
Gene ID (Entrez)	29904
Formulation	50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

225

Invitrogen™ Human CDK2/cyclin E1, GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Conjugate	Unconjugated
Form	Liquid
Common Name	CDK2
Molecular Weight (g/mol)	60.2-73.4 kDa
Concentration	See Label
Expression System	Baculovirus
For Use With (Application)	Kinase Assay
Name	Human CDK2/cyclin E1, GST Tag
Accession Number	P24941
Gene Alias	A630093N05Rik; CDC28; CDC2A; cdc2-related protein kinase; CDK1; CDK2; CDKN2; Cell division protein kinase 2; cyclin dependent kinase 2; cyclin dependent kinase 2-alpha; cyclin-dependent kinase 2; EC 2.7.11.22; EC 2.7.11.23; kinase Cdc2; MPF; p33 protein kinase; p33(CDK2); p33CDK2; p34 protein kinase
Protein Length	1-298
Gene ID (Entrez)	1017
Formulation	50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

Prev
1
...
13
14
15
16
...
7,232
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results