Recombinant Proteins

Search Within Results

2,821 – 2,835 of 122,825 results

2,821

R&D Systems™ Recombinant Human Thrombopoietin His (HEK-293) Protein

Analyzed by SEC-MALS. His-tag (HEK-293-expressed)

Pricing & Availability
Specifications

Accession Number	P40225.1
Purity or Quality Grade	>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining.
Conjugate	Unconjugated
Gene Alias	Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, megakaryocyte stimulating factor, MGDF, MGDFC-mpl ligand, MKCSF, MK-CSF, ML, MPL ligand, MPLLG, MPLLGMGC163194, Myeloproliferative leukemia virus oncogene ligand, THCYT1, THPO, thrombopoietin, thrombopoietin nirs variant 1, Tpo, TPOMKCSF
Molecular Weight (g/mol)	MolecularWeight-observed: 26-30 kDa, under reducing conditions., MolecularWeight-theroretical: 19 kDa
Gene ID (Entrez)	7066
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution	Reconstitute the 10 μg size at 100 μg/mL in PBS. Reconstitute all other sizes (at 500 μg/mL in PBS.)
Endotoxin Concentration	<0.10 EU / 1 μg of the protein by the LAL method.
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution.
For Use With (Application)	Bioactivity
Protein	Thrombopoietin/THPO
Source	Human embryonic kidney cell, HEK293-derived human Thrombopoietin/Tpo protein Ser22-Leu195, with a C-terminal 6-His tag

2,822

Novus Biologicals™ Recombinant Rabbit CCL3/MIP-1 alpha Protein

Recombinant Protein

Pricing & Availability

2,823

Novus Biologicals™ Recombinant Human ARL4 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,824

Novus Biologicals™ Adrenomedullin/ADM Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

2,825

Invitrogen™ SARS-CoV-2 Spike Protein (RBD) (F456L) His-tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% as determined by SDS-PAGE.
Conjugate	Unconjugated
pH Range	7.4
Form	Lyophilized
Molecular Weight (g/mol)	35.1 kDa
Common Name	SARS-CoV-2 Spike Protein RBD
Endotoxin Concentration	<1.0 EU/μg
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	SARS-CoV-2 spike RBD (Accession # YP_009724390.1), amino acids Arg319-Phe541 with an F456L substitution and a C-terminal His-tag
Expression System	HEK293 cells
For Use With (Application)	Control,Neutralization
Name	SARS-CoV-2 Spike Protein (RBD) (F456L) His-tag
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Coronavirus; COVID; Covid 19; COVID19; COVID-19; SARS; SARS Coronavirus; SARS CoV; SARS CoV2; SARS CoV-2; SARS Spike Protein; SARS-CoV2; SARS-CoV-2
Product Type	Protein
Formulation	PBS with 0.01% mannitol, 5-8% trehalose, 0.01% Tween 80 and no preservative; pH 7.4
Protein Tag	His-tag
Recombinant	Recombinant

2,826

Novus Biologicals™ Recombinant Human Annexin V Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

2,827

MilliporeSigma™ Human BMP-2 Recombinant Protein

Pricing & Availability

2,828

Promotions Available

Invitrogen™ Human ICE1 (aa 410-502) Control Fragment Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Conjugate	Unconjugated
pH Range	7.4
Form	Liquid
Common Name	ICE1
Gene Symbol	ICE1
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	NKGSGTWEEKPKSHEAIQALNTWEVNKVTTSGLETFTATLRESSATHSLVGEKHWTTASRSMSDRKRDILHETKTQMEVREMDKSVQTEKTIH
Concentration	≥5.0 mg/mL
Expression System	E. coli
For Use With (Application)	Neutralization,Control
Name	Human ICE1 (aa 410-502) Control Fragment
Accession Number	Q9Y2F5
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	ATICE1; C77245; ICE1; INDUCER OF CBF EXPRESSION 1; interactor of little elongation complex ELL subunit 1; interactor of little elongator complex ELL subunit 1; KIAA0947; little elongation complex subunit 1; mKIAA0947; SCREAM; SCRM
Product Type	Protein
Gene ID (Entrez)	23379
Formulation	PBS, 1M urea with no preservative; pH 7.4
Protein Tag	His-ABP-tag
Recombinant	Recombinant

2,829

Invitrogen™ SARS-CoV-2 Spike Protein S1/S2 (mutant) His-tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>90% as determined by SDS-PAGE.
Conjugate	Unconjugated
pH Range	8
Form	Lyophilized
Molecular Weight (g/mol)	134.1 kDa
Common Name	SARS-CoV-2 Spike Protein S1/S2
Endotoxin Concentration	<1.0 EU/μg
Storage Requirements	-20°C, Avoid Freeze/Thaw Cycles
Sequence	SARS-CoV-2 spike S1/S2 (Accession # YP_009724390.1), amino acids Met1-Pro1213 with an (HV69-70) deletion and D614G, D796H substitutions and a C-terminal His-tag
Expression System	Baculovirus
For Use With (Application)	Control,Neutralization
Name	SARS-CoV-2 Spike Protein S1/S2 (mutant) His-tag
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Coronavirus; COVID; Covid 19; COVID19; COVID-19; SARS; SARS Coronavirus; SARS CoV; SARS CoV2; SARS CoV-2; SARS Spike Protein; SARS-CoV2; SARS-CoV-2
Product Type	Protein
Formulation	20mM tris with 10% glycerol, 0.01% mannitol, 300mM NaCl, 5-8% trehalose, 0.01% Tween 80 and no preservative; pH 8
Protein Tag	His-tag
Recombinant	Recombinant

2,830

Novus Biologicals™ Recombinant Mouse OX40 Ligand/TNFSF4 Protein

Highly purified. Generating reliable and reproducible results. Applications: In vitro assay, SDS-Page

Pricing & Availability

2,831

R&D Systems™ Recombinant BatCoV RaTG13 Spike RBD Fc Chimera Protein

Carrier Free Recombinant Protein

Pricing & Availability

2,832

Novus Biologicals™ Ran Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	Ran
Molecular Weight (g/mol)	26.5kDa
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1.0mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Recombinant human RAN, fused to His-tag at N-terminus, expressed in E. coli
Accession Number	NP_006316
Regulatory Status	RUO
Purification Method	Protein
Gene ID (Entrez)	5901
Formulation	In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol
Immunogen	RAN, 1-216aa, Human, His tag, E. coli (NP_006316).
Recombinant	Recombinant

2,833

Novus Biologicals EPPIN-WFDC6 Recombinant Protein Antigen

Pricing & Availability

2,834

Novus Biologicals™ Recombinant Human LIMD2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,835

R&D Systems™ Recombinant Mouse Neogenin Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability

Prev
1
...
187
188
189
190
...
8,189
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Rabbit CCL3/MIP-1 alpha Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ARL4 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Adrenomedullin/ADM Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Annexin V Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Mouse OX40 Ligand/TNFSF4 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Ran Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals EPPIN-WFDC6 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human LIMD2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Rabbit CCL3/MIP-1 alpha Protein

Novus Biologicals™ Recombinant Human ARL4 His Protein

Novus Biologicals™ Adrenomedullin/ADM Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human Annexin V Protein

Novus Biologicals™ Recombinant Mouse OX40 Ligand/TNFSF4 Protein

Novus Biologicals™ Ran Protein

Novus Biologicals EPPIN-WFDC6 Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human LIMD2 His Protein