Recombinant Proteins
- (2)
- (970)
- (1)
- (23,543)
- (5)
- (1)
- (1)
- (67)
- (219)
- (4,425)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,461)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,606)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,166)
- (266)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,782)
- (1,408)
- (3)
- (4)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,525)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (201)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,728)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (25,926)
- (240)
- (1)
- (3)
- (286)
- (2)
- (61,756)
- (1)
- (15)
- (1)
- (2)
- (45,218)
- (5,703)
- (245)
- (168)
- (56)
- (3,364)
- (2)
- (1)
- (2)
- (1)
- (21)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,050)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,022)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (38,959)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ Rab7a Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | Rab7a |
| Molecular Weight (g/mol) | 25.6kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 100mM NaCl |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
Novus Biologicals™ Recombinant Human uPAR His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | CD87, CD87 antigen, Monocyte activation antigen Mo3, plasminogen activator, urokinase receptor, uPAR, U-PAR, UPARurokinase plasminogen activator surface receptor, u-plasminogen activator receptor form 2, URKRMO3 |
| Common Name | uPAR |
| Molecular Weight (g/mol) | TMW: 32.5kDa |
| Gene ID (Entrez) | 5329 |
| Formulation | Phosphate buffered saline (pH 7.4) containing 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
| Source | Baculovirus |
| Recombinant | Recombinant |
Novus Biologicals™ alpha 1-Microglobulin Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Recombinant SARS-CoV-2 nsp1 His (N-Term) Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
R&D Systems™ Recombinant Human MICB (aa 23-298) Fc Chimera Protein
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity
R&D Systems™ Recombinant Mouse TrkB Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
R&D Systems™ Recombinant Mouse CXCL7/Thymus Chemokine-1 (aa 40-113)
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
| Purity or Quality Grade | 97%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 8.2 kDa |
| Gene ID (Entrez) | 57349 |
| Quantity | 25 μg |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | E. coli-derived mouse CXCL7/Thymus Chemokine-1 protein Lys40-Tyr113 |
| Recombinant | Recombinant |
| Name | CXCL7/Thymus Chemokine-1 aa 40-113 |
R&D Systems™ Recombinant Mouse Kallikrein 7 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Human Endosialin/CD248 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
R&D Systems™ Recombinant Mouse ROBO2 Fc Chimera Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ PCBD1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | PCBD1 |
| Molecular Weight (g/mol) | 14.1kDa |
| Gene ID (Entrez) | 5092 |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol |
| Immunogen | PCBD1, 1- 104 aa. MGSSHHHHHHSSGLVPRGSHMAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
R&D Systems™ Recombinant Mouse EGFLAM Flag-tag Protein
Measured by its binding ability in a functional ELISA.
Novus Biologicals™ Recombinant Human ZNDR1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.