Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (2)
- (970)
- (1)
- (23,544)
- (5)
- (1)
- (1)
- (67)
- (220)
- (4,416)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,464)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,718)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,220)
- (265)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,924)
- (1,408)
- (3)
- (4)
- (5)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (137)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (82)
- (12)
- (2)
- (3)
- (86)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,525)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (199)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,726)
- (6)
- (4)
- (1)
- (3)
- (1)
- (4)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (26,017)
- (237)
- (1)
- (3)
Recombinant
- (286)
- (2)
- (62,014)
- (1)
Form
- (15)
- (1)
- (2)
- (45,312)
- (5,865)
- (245)
- (168)
- (56)
- (3,364)
Species
- (2)
- (1)
- (2)
- (1)
- (21)
- (560)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,139)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,027)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,575)
- (1)
- (50)
Conjugate
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (46)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (39,212)
- (1)
- (11)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
526
–
540
of
115,953
results
526
Novus Biologicals™ Recombinant Human Troponin C (cardiac) His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
527
-His-(C-Term)-Protein-ELISA-NBP3-07951-img0002.jpg-250.jpg)
Novus Biologicals™ Recombinant SARS-CoV-2 Spike (RBD+SD1+SD2) His (C-Term) Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
528
Novus Biologicals™ EB3 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | EB3 |
| Molecular Weight (g/mol) | 34.1kDa |
| Gene ID (Entrez) | 22924 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl |
| Immunogen | MAPRE3, 1-281 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
529
Novus Biologicals™ PIN/DLC8 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | PIN/DLC8 |
| Molecular Weight (g/mol) | 12.5kDa |
| Gene ID (Entrez) | 8655 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 1mM DTT, 10% glycerol |
| Immunogen | DYNLL1, 1-89 aa. MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
530
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 0.02 M tris HCl with 50% glycerol and no preservative; pH 8 |
| Sequence | Amino acids Gln28- Val482 containing an N-terminal His-tag |
| Concentration | 1 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human ICAM-1 (CD54) |
| Recombinant | Recombinant |
531
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | tris HCl with 50% glycerol, 5 mM EDTA and no preservative; pH 8 |
| Sequence | Amino acids Met1- His430 containing an N-terminal His-tag |
| Concentration | 0.8 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human Cytokeratin 18 |
| Recombinant | Recombinant |
532
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 0.025 M sodium acetate with 1 mM EDTA, 50% glycerol and no preservative; pH 4.8 |
| Sequence | Amino acids Ser82-Thr190 containing an N-terminal His-tag |
| Concentration | 0.11 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human PDGF-B |
| Recombinant | Recombinant |
533
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | PBS with 50% glycerol and no preservative |
| Sequence | Amino acids Ser2- Leu434 containing an N-terminal His-tag |
| Concentration | 2.35 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human NSE |
| Recombinant | Recombinant |
534
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 59.18 kDa |
| Formulation | 0.025 M tris HCl with 0.02 mM EDTA, 50% glycerol, 75 mM NaCl and no preservative; pH 8.0 |
| Sequence | Amino acids Met29-Tyr505 containing an N-terminal His-tag |
| Concentration | 0.972 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human PPAR-gamma |
| Recombinant | Recombinant |
535
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 21.88 kDa |
| Formulation | Laemmli with no preservative; pH 6.8 |
| Sequence | Amino acids Ala117-Ser269 containing an N-terminal His-tag |
| Concentration | 0.05 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human IL-1 beta |
| Recombinant | Recombinant |
536
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 20 mM tris HCl with 50% glycerol and no preservative; pH 8 |
| Sequence | Amino acids Met1- Leu354 containing an N-terminal His-tag |
| Concentration | 0.10 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human PON2 |
| Recombinant | Recombinant |
537
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 0.025 M sodium acetate with 50% glycerol and no preservative; pH 4.8 |
| Sequence | Amino acids Val24-Pro402 containing an N-terminal His-tag |
| Concentration | 0.10 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human PAI-1 (Serpin E1) |
| Recombinant | Recombinant |
538
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions |
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 55.92 kDa |
| Formulation | 25 mM sodium acetate with 50% glycerol and no preservative; pH 4.8 |
| Sequence | Amino acids Met1- Lys452 containing an N-terminal His-tag |
| Concentration | 0.113 mg/mL |
| For Use With (Application) | Control,Western Blot |
| Source | E. coli |
| Name | Human ILK |
| Recombinant | Recombinant |
539
| Accession Number | YP_009724390.1 |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining. |
| Conjugate | Unconjugated |
| Gene Alias | SARS-CoV-2 |
| Molecular Weight (g/mol) | M.W.-observed: 106-121 kDa, under reducing conditions, M.W.-theoretical: 75 kDa |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20°C to -70°C as supplied. 1 month, 2°C to 8°C under sterile conditions after reconstitution. 3 months, -20°C to -70°C under sterile conditions after reconstitution. |
| For Use With (Application) | Bioactivity |
| Protein | SARS-CoV-2 Spike S1 Protein |
| Source | Human embryonic kidney cell, HEK293-derived sars-cov-2 Spike S1 Subunit protein Val16-Pro681, with a C-terminal 6-His tag |
