Recombinant Proteins
- (2)
- (970)
- (1)
- (23,542)
- (5)
- (1)
- (1)
- (67)
- (218)
- (4,423)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,453)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (22,601)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,157)
- (255)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,765)
- (1,407)
- (3)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (198)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,728)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (25,917)
- (240)
- (1)
- (3)
- (286)
- (2)
- (61,720)
- (1)
- (15)
- (1)
- (2)
- (45,213)
- (5,673)
- (245)
- (168)
- (56)
- (3,363)
- (2)
- (1)
- (2)
- (1)
- (21)
- (558)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,042)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,017)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (38,925)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ Recombinant Human Proteasome 26S S5 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | KIAA007226S proteasome non-ATPase regulatory subunit 5, proteasome (prosome, macropain) 26S subunit, non-ATPase, 5,26S proteasome subunit S5B, S5BMGC23145,26S protease subunit S5 basic |
| Common Name | Proteasome 26S S5 |
| Molecular Weight (g/mol) | TMW: 58.9kDa |
| Gene ID (Entrez) | 5711 |
| Formulation | Phosphate buffered saline (pH7.4) containing 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Novus Biologicals™ EIF3J Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
R&D Systems™ Recombinant Mouse IFN-epsilon Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
BD Recombinant Rat Interleukin-10 (IL-10)
For inhibition of proinflammatory T cell mediated immunity
Gibco™ Human FGF-6 Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | ≥95% by SDS-PAGE and HPLC |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.2 |
| Form | Lyophilized |
| Molecular Weight (g/mol) | 18.7 kDa |
| Common Name | FGF6 |
| Gene Symbol | FGF6 |
| Activity | ED50 ≤ 0.1 ng/mL; determined by the dose-dependent proliferation of Balb/c 3T3 cells. |
| Endotoxin Concentration | <0.1 ng/μg |
| Storage Requirements | -20°C |
| Sequence | Human FGF-6 recombinant protein contains 168 amino acids |
| Expression System | E. coli |
| For Use With (Application) | Bioactivity |
| Name | Human FGF-6 |
| Accession Number | P10767 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | FGF; FGF6; Fgf-6; Fibroblast growth factor; Fibroblast growth factor 6; HBGF-6; Heparin secretory-transforming protein 2; heparin-binding growth factor 6; HST2; HST-2; Hstf2; HSTF-2 |
| Product Type | Protein |
| Gene ID (Entrez) | 2251 |
| Formulation | 10mM sodium phosphate with 50mM NaCl and no preservative; pH 7.2 |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human BCMA/TNFRSF17 hIgG-His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | B cell maturation antigen, B-cell maturation protein, BCMAtumor necrosis factor receptor superfamily member 17, BCMB-cell maturation factor, CD269, CD269 antigen, tumor necrosis factor receptor superfamily, member 17 |
| Common Name | BCMA/TNFRSF17 |
| Molecular Weight (g/mol) | TMW: 33.1kDa |
| Gene ID (Entrez) | 608 |
| Formulation | Phosphate buffered saline (pH 7.4) containing 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
| Source | Baculovirus |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human Tyrosine Hydroxylase His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: Western Blot, Immunohistochemistry-Paraffin, SDS-Page
| Formulation | 300 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO4, 1.47 mM KH2PO4, 5% glycerol, 1 mM DTT, pH 7.4 |
|---|---|
| Gene ID (Entrez) | 7054 |
| Storage Requirements | −80°C. Avoid freeze-thaw cycles. |
Novus Biologicals™ MMAB Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | MMAB |
| Molecular Weight (g/mol) | 26.3kDa |
| Formulation | Liquid. In 20mM Tris-HCl Buffer (pH 7.5) containing 10% Glycerol |
| Immunogen | Human MMAB from amino acid 33-250 expressed in E. Coli. MGSSHHHHHHSSGLVPRGSHMQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKKNDPSAESEGL |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Novus Biologicals™ BPNT1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | BPNT1 |
| Molecular Weight (g/mol) | 37.5kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 5mM DTT, 0.1M NaCl. |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
R&D Systems™ Recombinant Mouse Contactin-3 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ Recombinant Human HMGA1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page