Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (2)
- (2,280)
- (1)
- (23,537)
- (5)
- (1)
- (1)
- (67)
- (365)
- (5,063)
- (23)
- (1)
- (7)
- (2)
- (13)
- (21,434)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (23,043)
- (1)
- (1)
- (2)
- (1)
- (25)
- (34,526)
- (399)
- (2)
- (2)
- (32)
- (3)
- (724)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (114)
- (1)
- (3,801)
- (1,405)
- (3)
- (4)
- (6)
- (5)
- (1)
- (1)
- (1)
- (1)
- (1)
- (14)
- (7,895)
- (48)
- (6)
- (29)
- (16)
- (1)
- (10)
- (4)
- (104)
- (14)
- (2)
- (3)
- (111)
- (4)
- (143)
- (98)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,563)
- (2)
- (1)
- (160)
- (18)
- (48)
- (11)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (521)
- (2,939)
- (1)
- (4)
- (1)
- (2)
- (114)
- (1,559)
- (4)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (31,409)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (2)
- (1)
- (1)
- (7,668)
- (6)
- (2)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (14)
- (17)
- (1)
- (3)
- (3)
- (4)
- (34,821)
- (233)
- (1)
- (3)
Recombinant
- (285)
- (9)
- (66,412)
- (1)
Form
- (15)
- (1)
- (2)
- (45,210)
- (10,347)
- (245)
- (168)
- (56)
- (3,358)
Species
- (2)
- (1)
- (2)
- (1)
- (89)
- (557)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,305)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,096)
- (5)
- (22)
- (8)
- (4)
- (1,291)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,572)
- (1)
- (48)
Conjugate
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (61)
- (1)
- (2)
- (3)
- (1)
- (424)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (5)
- (18)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (43,644)
- (1)
- (11)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
766
–
780
of
129,988
results
Invitrogen™ Human FYN A, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| Molecular Weight (g/mol) | 87.1 kDa |
| Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human FYN A, GST Tag |
| Recombinant | Recombinant |
Invitrogen™ Human CDK2/cyclin E1, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | CDK2 |
| Molecular Weight (g/mol) | 60.2-73.4 kDa |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human CDK2/cyclin E1, GST Tag |
| Accession Number | P24941 |
| Gene Alias | A630093N05Rik; CDC28; CDC2A; cdc2-related protein kinase; CDK1; CDK2; CDKN2; Cell division protein kinase 2; cyclin dependent kinase 2; cyclin dependent kinase 2-alpha; cyclin-dependent kinase 2; EC 2.7.11.22; EC 2.7.11.23; kinase Cdc2; MPF; p33 protein kinase; p33(CDK2); p33CDK2; p34 protein kinase |
| Protein Length | 1-298 |
| Gene ID (Entrez) | 1017 |
| Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human TEX264 (aa 107-184) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TEX264 (aa 107-184) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human ROCK2, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | ROCK2 |
| Molecular Weight (g/mol) | 90.8 kDa |
| KinaseFamily | DMPK Kinase Family |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human ROCK2, GST Tag |
| Accession Number | O75116 |
| Gene Alias | B230113H15Rik; KIAA0619; mKIAA0619; p150 ROK-alpha; p164 ROCK-2; Rho associated coiled-coil containing protein kinase 2; Rho kinase 2; RhoA - binding serine/threosine kinase alpha (ROK - alpha); rhoA-binding kinase 2; Rho-associated coiled-coil containing protein kinase 2; Rho-associated coiled-coil forming kinage 2; Rho-associated coiled-coil forming kinase 2; rho-associated protein kinase 2; Rho-associated, coiled-coil-containing protein kinase 2; rho-associated, coiled-coil-containing protein kinase II; Rho-kinase; ROCK II; Rock2; Rock2m; rockii; ROCK-II; ROK; ROKalpha |
| Protein Length | 1-552 |
| Gene ID (Entrez) | 9475 |
| Formulation | 50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human FYN, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | Fyn |
| Molecular Weight (g/mol) | 62.7 kDa |
| Sequence | Full length |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human FYN, His Tag |
| Accession Number | P06241 |
| Gene Alias | AI448320; AW552119; C syn protooncogene; c-syn protooncogene; EC 2.7.10.2; Fyn; fyn {ECO:0000312; FYN oncogene related to SRC, FGR, YES; Fyn proto-oncogene; FYN proto-oncogene, Src family tyrosine kinase; kinase Fyn; MGC45350; OKT3-induced calcium influx regulator; OTTHUMP00000017916; OTTHUMP00000017917; P59 p59-Fyn; p59-Fyn; Proto-oncogene c-Fyn; Protooncogene Syn; proto-oncogene Syn; proto-oncogene tyrosine-protein kinase Fyn; RGD:2641}; RP1-66H14.1; SLK; Src Kinase p59; Src like kinase; src/yes-related novel; src-like kinase; SYN; tyrosine kinase p59fyn(T); tyrosine-protein kinase Fyn |
| Product Type | FYN Recombinant Human Protein |
| Gene ID (Entrez) | 2534 |
| Formulation | 20 mM tris with 0.05% NP-40, 0.05 mM EDTA, 100 mM NaCl, 1 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human uPAR (aa 51-156) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human uPAR (aa 51-156) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human Tartrate Resistant Acid Phosphatase (aa 35-121) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | GGVPNAPFHTAREMANAKEIARTVQILGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Tartrate Resistant Acid Phosphatase (aa 35-121) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human FGFR4, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| Molecular Weight (g/mol) | 42.6 kDa |
| Formulation | 50 mM tris with 0.01% NP-40, 0.01 mM EDTA, 100 mM NaCl, 1 mM DTT, 20% glycerol and no preservative; pH 7.5 |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human FGFR4, His Tag |
| Recombinant | Recombinant |
Invitrogen™ Human AKT2 (PKB beta), His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| Molecular Weight (g/mol) | 59.1 kDa |
| Formulation | 20 mM tris with 0.01% Triton X-100, 0.1 mM sodium orthovanadate, 0.5 mM EDTA, 150 mM NaCl, 20% glycerol, 2 mM DTT and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human AKT2 (PKB beta), His Tag |
| Recombinant | Recombinant |
Invitrogen™ Human STK17A (DRAK1), GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| Molecular Weight (g/mol) | 74 kDa |
| Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human STK17A (DRAK1), GST Tag |
| Recombinant | Recombinant |
Invitrogen™ Human BRAF, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | B-Raf |
| Molecular Weight (g/mol) | 113.6 kDa |
| KinaseFamily | RAF Kinase Family |
| Sequence | Full length |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human BRAF, GST Tag |
| Accession Number | P15056 |
| Gene Alias | 94 kDa B-raf protein; 9930012E13Rik; AA120551; AA387315; AA473386; Braf; B-raf; B-raf protein; B-raf protein isoform 1; B-raf protein isoform 2; B-Raf proto-oncogene serine/threonine-protein kinase; B-Raf proto-oncogene serine/threonine-protein kinase (p94); B-Raf proto-oncogene, serine/threonine kinase; Braf transforming gene; BRAF1; B-RAF1; Braf2; Braf-2; C230098H17; C87398; C-RMIL; D6Ertd631e; FLJ95109; MGC126806; murine sarcoma viral (v-raf) oncogene homolog B1; NS7; p94; Proto-oncogene B-Raf; proto-oncogene c-Rmil; RAFB1; RMIL; rmil serine/threonine-protein kinase; serine/threonine kinase; serine/threonine-protein kinase B-raf; Serine/threonine-protein kinase Rmil; v-raf murine sarcoma viral oncogene homolog B; v-raf murine sarcoma viral oncogene homolog B1 |
| Gene ID (Entrez) | 673 |
| Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human PKN2 (PRK2), GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| Molecular Weight (g/mol) | 141.5 kDa |
| Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human PKN2 (PRK2), GST Tag |
| Recombinant | Recombinant |
Invitrogen™ Human JAK3, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | 90% by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 67.4 kDa |
| Formulation | 50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human JAK3, GST Tag |
| Recombinant | Recombinant |
Invitrogen™ Human ICK, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | ICK |
| Molecular Weight (g/mol) | 95.1 kDa |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human ICK, GST Tag |
| Accession Number | Q9UPZ9 |
| Gene Alias | 2210420N10Rik; AI848300; ciliogenesis associated kinase 1; CILK1; ECO; heart serine-threonine protein kinase; hICK; iciliogenesis associated kinase 1; ICK; intestinal cell (MAK-like) kinase; intestinal cell kinase; KIAA0936; Laryngeal cancer kinase 2; LCK2; MAK-related kinase; mICK; MRK; serine/threonine protein kinase; serine/threonine-protein kinase ICK |
| Protein Length | 1-632 |
| Gene ID (Entrez) | 22858 |
| Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ ER Beta Recombinant Protein, Ligand Binding Domain, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | 98% by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 50 mM tris HCl with 0.02% NP-40, 0.5 mM EDTA, 20% glycerol, 500 mM KCl, 5 mM DTT and no preservative; pH 8 |
| Concentration | See Label |
| For Use With (Application) | Nuclear Receptor Assay |
| Name | ER Beta Recombinant Protein, Ligand Binding Domain, GST Tag |
| Recombinant | Recombinant |