Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

1,036 – 1,050 of 119,730 results

1,036

R&D Systems™ Recombinant Mouse Syndecan-3 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

1,037

Novus Biologicals™ SRM Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	SRM
Molecular Weight (g/mol)	36kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl.
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE

1,038

Novus Biologicals™ Recombinant Human Calponin 2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	calponin 2, Calponin H2, smooth muscle, calponin-2, Neutral calponin
Common Name	Calponin 2
Molecular Weight (g/mol)	TMW: 16.9kDa
Gene ID (Entrez)	1265
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

1,039

Promotions Available

R&D Systems™ Recombinant Human Siglec-3/CD33 Protein, Atto 647N Conjugate

Fc Chimera

Pricing & Availability

1,040

Novus Biologicals™ Apolipoprotein A-II/ApoA2 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

1,041

R&D Systems™ Recombinant Human Frizzled-10 Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability

1,042

Promotions Available

R&D Systems™ Recombinant Mouse CD6 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

1,043

R&D Systems™ Recombinant Rat Growth Hormone R (GHR) Fc Chimera

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

1,044

Promotions Available

R&D Systems™ Recombinant Mouse IFN-alpha/beta R2 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

1,045

Novus Biologicals™ Recombinant Human IL-2 [ Cys Ser125]Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>97 % pure by SDS-PAGE and HPLC
Conjugate	Unconjugated
Form	Purified
Molecular Weight (g/mol)	MolecularWeight-theroretical: 15.5 kDa
Gene Symbol	IL2
Endotoxin Concentration	Less than 1.0 EU/μg of IL-2 AS determined by LAL method.
Storage Requirements	Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.)
For Use With (Application)	SDS-PAGE,Bioactivity
Protein	IL-2
Gene Alias	aldesleukin, IL-2, IL-2 lymphokine, interleukin 2, interleukin-2, involved in regulation of T-cell clonal expansion, T cell growth factor, T-cell growth factor, TCGF
Gene ID (Entrez)	3558
Formulation	Lyophilized from a 0.2 mm filtered concentrated solution in 20 mM PB (pH 3.5).
Research Category	Adaptive Immunity, Biologically Active Proteins, Cytokine Research, Diabetes Research, Immunology, Innate Immunity, Mast Cell Markers
Reconstitution	Briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to 0.1-1.0 mg/mL Stock solutions should be apportioned into working aliquots and stored (at -20°C.)
Species	Human
Recombinant	Recombinant

1,046

Novus Biologicals™ Recombinant Human RFXANK His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

1,047

Novus Biologicals™ Recombinant Human GOT2 His Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	aspartate aminotransferase, mitochondrial, EC 2.6.1, EC 2.6.1.1, FABP-1, FABPpm, Fatty acid-binding protein, FLJ40994, Glutamate oxaloacetate transaminase 2, glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase2), KAT4, KATIV, kynurenine aminotransferase IV, mAspAT, mitAAT, Plasma membrane-associated fatty acid-binding protein, Transaminase A
Biological Activity	Specific activity is > 60 units/mg, and is defined as the amount of enzyme that convert 1umole of alpha-ketoglutarate to L-Glutamate per minute at pH 8.0 at 25C.
Common Name	GOT2
Molecular Weight (g/mol)	TMW: 47kDa
Gene ID (Entrez)	2806
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 0.15M NaCl
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

1,048

Promotions Available

R&D Systems™ Recombinant Mouse CD42b/GPIb alpha Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

1,049

Novus Biologicals™ EIF1AX Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	EIF1AX
Molecular Weight (g/mol)	18.6kDa
Gene ID (Entrez)	1964
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 40% glycerol, 5mM DTT, 200mM NaCl
Immunogen	MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

1,050

R&D Systems™ Recombinant Cynomolgus B7-H6 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

Prev
1
...
68
69
70
71
...
7,982
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ SRM Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Calponin 2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Apolipoprotein A-II/ApoA2 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human IL-2 [ Cys Ser125]Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human RFXANK His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human GOT2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ EIF1AX Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ SRM Protein

Novus Biologicals™ Recombinant Human Calponin 2 His Protein

Novus Biologicals™ Apolipoprotein A-II/ApoA2 Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human IL-2 [ Cys Ser125]Protein

Novus Biologicals™ Recombinant Human RFXANK His Protein

Novus Biologicals™ Recombinant Human GOT2 His Protein

Novus Biologicals™ EIF1AX Protein