Primary amines
- (22)
- (141)
- (10)
- (8)
- (4)
- (29)
- (1)
- (4)
- (3)
- (1)
- (72)
- (35)
- (9)
- (2)
- (5)
- (1)
- (1)
- (2)
- (1)
- (1)
- (14)
- (4)
- (1)
- (3)
- (168)
- (57)
- (3)
- (13)
- (16)
- (21)
- (1)
- (6)
- (1)
- (1)
- (1)
- (4)
- (1)
- (181)
- (4)
- (28)
- (15)
- (5)
- (2)
- (41)
- (49)
- (2)
- (1)
- (4)
- (14)
- (3)
- (8)
- (4)
- (4)
- (5)
- (4)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (5)
- (2)
- (4)
- (1)
- (1)
- (24)
- (2)
- (2)
- (7)
- (6)
- (2)
- (4)
- (6)
- (7)
- (13)
- (4)
- (2)
- (2)
- (5)
- (13)
- (4)
- (7)
- (14)
- (4)
- (1)
- (1)
- (6)
- (1)
- (2)
- (10)
- (1)
- (4)
- (5)
- (2)
- (5)
- (2)
- (3)
- (2)
- (9)
- (1)
- (3)
- (4)
- (2)
- (2)
- (2)
- (1)
- (9)
- (1)
- (1)
- (3)
- (4)
- (9)
- (4)
- (6)
- (1)
- (2)
- (5)
- (2)
- (2)
- (2)
- (9)
- (5)
- (3)
- (5)
- (2)
- (2)
- (2)
- (6)
- (1)
- (1)
- (3)
- (3)
- (5)
- (1)
- (5)
- (3)
- (4)
- (2)
- (2)
- (3)
- (5)
- (8)
- (3)
- (1)
- (1)
- (2)
- (1)
- (3)
- (7)
- (5)
- (2)
- (3)
- (3)
- (2)
- (3)
- (2)
- (2)
- (8)
- (3)
- (2)
- (3)
- (3)
- (1)
- (8)
- (1)
- (1)
- (1)
- (6)
- (3)
- (8)
- (2)
- (2)
- (19)
- (4)
- (2)
- (9)
- (8)
- (1)
- (1)
- (1)
- (1)
- (5)
- (6)
- (2)
- (1)
- (5)
- (11)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (3)
- (11)
- (1)
- (9)
- (2)
- (1)
- (2)
- (6)
- (2)
- (1)
- (2)
- (4)
- (1)
- (1)
- (1)
- (2)
- (9)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (6)
- (4)
- (5)
- (1)
- (2)
- (1)
- (2)
- (9)
- (5)
- (16)
- (9)
- (2)
- (8)
- (17)
- (7)
- (5)
- (8)
- (10)
- (10)
- (24)
- (20)
- (1)
- (1)
- (5)
- (8)
- (7)
- (2)
- (1)
- (12)
- (6)
- (6)
- (21)
- (11)
- (7)
- (11)
- (8)
- (4)
- (3)
- (3)
- (8)
- (1)
- (2)
- (4)
- (1)
- (2)
- (2)
- (12)
- (3)
- (3)
- (5)
- (2)
- (7)
- (4)
- (15)
- (2)
- (3)
- (8)
- (6)
- (3)
- (45)
- (2)
- (40)
- (118)
- (2)
- (7)
- (9)
- (6)
- (18)
- (40)
- (4)
- (14)
- (1)
- (5)
- (13)
- (6)
- (11)
- (2)
- (2)
- (3)
- (4)
- (5)
- (3)
- (2)
- (1)
- (1)
- (13)
- (2)
- (18)
- (8)
- (77)
- (1)
- (161)
- (10)
- (5)
- (144)
- (29)
- (4)
- (2)
- (2)
- (8)
- (15)
- (177)
- (3)
- (1)
- (4)
- (3)
- (4)
- (2)
- (3)
- (331)
- (3)
- (4)
- (6)
- (4)
- (2)
- (27)
- (4)
- (4)
- (3)
- (2)
- (2)
- (3)
- (4)
- (5)
- (3)
- (3)
- (3)
- (3)
- (3)
- (6)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (5)
- (2)
- (3)
- (7)
- (13)
- (2)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (6)
- (2)
- (1)
- (2)
- (2)
- (3)
- (4)
- (2)
- (1)
- (3)
- (2)
- (3)
- (2)
- (2)
- (2)
- (8)
- (1)
- (1)
- (2)
- (5)
- (5)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (1)
- (4)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (3)
- (3)
- (3)
- (2)
- (4)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (4)
- (3)
- (2)
- (2)
- (3)
- (1)
- (3)
- (1)
- (4)
- (2)
- (2)
- (6)
- (4)
- (7)
- (3)
- (3)
- (2)
- (2)
- (4)
- (2)
- (7)
- (1)
- (3)
- (3)
- (3)
- (2)
- (1)
- (2)
- (6)
- (2)
- (4)
- (1)
- (4)
- (2)
- (3)
- (3)
- (3)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (3)
- (2)
- (1)
- (2)
- (2)
- (1)
- (3)
- (2)
- (5)
- (2)
- (2)
- (1)
- (5)
- (4)
- (2)
- (4)
- (2)
- (3)
- (2)
- (4)
- (3)
- (2)
- (6)
- (2)
- (1)
- (4)
- (6)
- (3)
- (2)
- (7)
- (2)
- (2)
- (3)
- (2)
- (2)
- (4)
- (10)
- (2)
- (1)
- (5)
- (5)
- (2)
- (1)
- (1)
- (2)
- (4)
- (4)
- (2)
- (2)
- (2)
- (4)
- (3)
- (2)
- (2)
- (2)
- (5)
- (4)
- (4)
- (4)
- (3)
- (2)
- (2)
- (2)
- (3)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (3)
- (1)
- (2)
- (3)
- (3)
- (1)
- (3)
- (4)
- (1)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (7)
- (2)
- (1)
Filtered Search Results
eMolecules TERT-BUTYLAMINE 10G
5000169428 TERT-BUTYLAMINE 10G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 2-aminoethanethiol | Broadpharm | 60-23-1 | MFCD00008196 | 77.150 | C2H7NS | 0.000 | NCCS | 5g | 309209162
2-aminoethanethiol | Broadpharm | 60-23-1 | MFCD00008196 | 77.150 | C2H7NS | 0.000 | NCCS | 5g | 309209162
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules CYCLOHEXANEMETHYLAMINE 25G
5000158404 CYCLOHEXANEMETHYLAMINE 25G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![Medchemexpress LLC 2-(4-hydroxyphenyl)-1-(1,3,4,9-tetrahydro-2H-pyrido[3,4-b]indol-2-yl)-ethanone | 1373764-75-0 | 98.3% | 50 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000232155.png-250.jpg)
Medchemexpress LLC 2-(4-hydroxyphenyl)-1-(1,3,4,9-tetrahydro-2H-pyrido[3,4-b]indol-2-yl)-ethanone | 1373764-75-0 | 98.3% | 50 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
YH-306 is a small-molecule focal adhesion kinase (FAK) inhibitor with reported antitumor activity. It suppresses colorectal tumor growth and metastasis by inhibiting FAK signaling, reducing cell migration and invasion, and promoting apoptosis.
- faK pathway inhibition reduces tumor cell migration and invasion.
- demonstrated antitumor activity in colorectal cancer models.
- modulates multiple signaling proteins including c-Src, paxillin, PI3K, and Rac1.
- downregulates MMP2 and MMP9 expression to limit metastasis.
- supplied as a research reagent, soluble in DMSO for experimental use.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC 12-(cyclohexylcarbamoylamino)dodecanoic acid | 479413-68-8 | 99.8% | 50MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
12-(cyclohexylcarbamoylamino)dodecanoic acid | 479413-68-8 | 99.8% | 50MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules EMOLECULES INC
NC3929716 2-ETHYL-1-HEXYLAMINE 25 GRAMS
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules N-BOC-ETHYLENEDIAMINE 100G
5000189619 N-BOC-ETHYLENEDIAMINE 100G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
![Medchemexpress LLC N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) | 64967-39-1 | 99.8% | 399.40 | 100 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000451708-logo.png-250.jpg){kind=logo}
Medchemexpress LLC N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) | 64967-39-1 | 99.8% | 399.40 | 100 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) | 64967-39-1 | 99.8% | 399.40 | 100 MG
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC PSB-0739 | 1052087-90-7 | 98.0% | 609.54 | C26H17N3Na2O8S2 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
PSB-0739 is a research-grade P2Y12 receptor antagonist used for laboratory studies of platelet aggregation and P2Y12 signaling. It is a high-affinity, potent, competitive, non-nucleotide small molecule (CAS 1052087-90-7; MW 609.54) supplied as a solid intended for research use only.
- High-affinity P2Y12 receptor antagonist (Ki = 24.9 nM).
- Potent competitive non-nucleotide antagonist in vitro (pA2 = 9.8).
- Inhibits ADP-evoked Ca2+ responses (EC50 ≈ 5.4 μM).
- Purity 98.0%.
- Intended for research use only.
- Store sealed at 4°C; in solvent: -80°C for long term.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC (E)-3-(2-Furyl)acrolein | 39511-08-5 | MFCD00003256 | 97% | 122.12 | 10 G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
(E)-3-(2-Furyl)acrolein, derived from a 2-acid-acid-rich acid reaction, finds applications in various fields including food, cosmetics, medicine, and agriculture. In the food industry, it serves as a natural seasoning food additive with significant flavoring properties. It is also described as a biochemical reagent suitable for life science related research as a biological material or organic compound.
- Used in food, cosmetics, medicine, and agriculture
- Acts as a natural seasoning food additive in the food industry
- Biochemical reagent for life science research
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Chem-Impex International, Inc. Methallylamine | 2878-14-0 | MFCD00053646 | 1G
Methallylamine, 2878-14-0, MFCD00053646, 1G
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules 2-Hydroxy-3-pyridyl ethylamine dihydrochloride | 101012-01-5 | MFCD09028161 | 1g
Chem-Impex | 2-Hydroxy-3-pyridyl ethylamine dihydrochloride | 1g | 112758672 | 23828 | | 101012-01-5 | MFCD09028161 | 211.090 | C7H12Cl2N2O
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC ICCB-19 (hydrochloride) | 1803605-68-6 | 99.3% | 291.84 | C12H22ClN3OS | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
ICCB-19 hydrochloride is a research-grade small molecule that inhibits TRADD-mediated signaling and indirectly inhibits RIPK1 kinase activity. It has been reported to induce autophagy, modulate TNF-induced inflammatory responses, and affect RIPK1-dependent apoptosis in cellular and animal models.
- Targets TRADD and indirectly inhibits RIPK1 kinase activity.
- Binds TRADD N-terminal domain to disrupt protein interactions.
- Promotes autophagy via K63-linked ubiquitination of Beclin-1.
- Reduces TNF-induced inflammatory gene expression in cell and animal studies.
- Provided as a hydrochloride salt with reported high purity.
- Available as solid and DMSO solution aliquots for research use.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Biotium TS BIOTIN-X ETHYLENEDIAMINE 10
TS BIOTIN-X ETHYLENEDIAMINE 10
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More