Primary amines
Organic compounds and functional groups that contain a basic nitrogen atom with a lone pair. Primary amines have a nitrogen atom bonded to two hydrogen atoms, and a carbon atom or other functional group.
Quantity
- (22)
- (140)
- (10)
- (8)
- (4)
- (29)
- (1)
- (4)
- (3)
- (1)
- (72)
- (35)
- (8)
- (2)
- (5)
- (1)
- (1)
- (2)
- (1)
- (1)
- (14)
- (4)
- (1)
- (3)
- (169)
- (57)
- (4)
- (13)
- (17)
- (20)
- (1)
- (6)
- (1)
- (1)
- (1)
- (4)
- (1)
- (181)
- (4)
- (28)
- (15)
- (5)
- (2)
- (41)
- (49)
- (2)
- (1)
- (4)
Molecular Weight (g/mol)
- (14)
- (3)
- (8)
- (4)
- (4)
- (5)
- (4)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (5)
- (1)
- (2)
- (4)
- (1)
- (1)
- (24)
- (2)
- (3)
- (4)
- (7)
- (6)
- (2)
- (3)
- (6)
- (7)
- (13)
- (4)
- (2)
- (2)
- (5)
- (13)
- (4)
- (7)
- (14)
- (4)
- (1)
- (1)
- (6)
- (1)
- (2)
- (10)
- (1)
- (4)
- (5)
- (2)
- (5)
- (2)
- (3)
- (2)
- (9)
- (1)
- (3)
- (4)
- (2)
- (2)
- (2)
- (1)
- (9)
- (1)
- (1)
- (3)
- (4)
- (9)
- (4)
- (6)
- (1)
- (2)
- (5)
- (2)
- (2)
- (2)
- (9)
- (5)
- (3)
- (5)
- (2)
- (2)
- (2)
- (6)
- (1)
- (1)
- (3)
- (3)
- (5)
- (1)
- (5)
- (3)
- (4)
- (2)
- (2)
- (3)
- (5)
- (8)
- (3)
- (1)
- (1)
- (2)
- (3)
- (7)
- (5)
- (2)
- (3)
- (3)
- (2)
- (3)
- (2)
- (2)
- (8)
- (3)
- (2)
- (3)
- (3)
- (8)
- (1)
- (1)
- (1)
- (6)
- (3)
- (8)
- (2)
- (2)
- (19)
- (4)
- (2)
- (9)
- (8)
- (1)
- (1)
- (1)
- (5)
- (6)
- (2)
- (1)
- (5)
- (11)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (3)
- (11)
- (1)
- (9)
- (2)
- (1)
- (2)
- (6)
- (2)
- (2)
- (4)
- (1)
- (1)
- (1)
- (2)
- (9)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (7)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (5)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (6)
- (4)
- (5)
- (1)
- (2)
- (1)
- (2)
- (9)
- (5)
- (16)
- (9)
- (2)
- (8)
- (17)
- (7)
- (5)
- (8)
- (10)
- (10)
- (24)
- (20)
- (2)
- (1)
- (5)
- (8)
- (7)
- (2)
- (1)
- (12)
- (6)
- (6)
- (21)
- (11)
- (7)
- (11)
- (8)
- (4)
- (3)
- (3)
- (8)
- (1)
Percent Purity
- (2)
- (4)
- (1)
- (2)
- (2)
- (12)
- (3)
- (3)
- (5)
- (2)
- (7)
- (4)
- (15)
- (2)
- (3)
- (8)
- (6)
- (3)
- (45)
- (2)
- (40)
- (118)
- (2)
- (7)
- (9)
- (6)
- (18)
- (40)
- (4)
- (14)
- (1)
- (6)
- (13)
- (6)
- (11)
- (2)
- (2)
- (3)
- (4)
- (5)
- (3)
- (2)
- (1)
- (1)
- (13)
- (2)
- (18)
- (8)
- (76)
- (1)
- (161)
- (10)
- (5)
- (144)
- (29)
- (4)
Physical Form
- (2)
- (2)
- (8)
- (15)
- (177)
- (3)
- (5)
- (1)
- (4)
- (3)
- (4)
- (2)
- (3)
- (331)
- (3)
- (4)
- (6)
- (4)
- (2)
- (27)
- (5)
- (4)
- (4)
- (3)
- (2)
- (2)
- (3)
Boiling Point
- (4)
- (5)
- (3)
- (3)
- (3)
- (3)
- (3)
- (6)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (5)
- (2)
- (3)
- (7)
- (13)
- (2)
- (3)
- (2)
- (2)
- (3)
- (2)
- (1)
- (3)
- (6)
- (2)
- (1)
- (2)
- (2)
- (3)
- (4)
- (2)
- (1)
- (3)
- (2)
- (3)
- (1)
- (2)
- (2)
- (8)
- (1)
- (1)
- (2)
- (5)
- (5)
- (2)
- (3)
- (1)
- (2)
- (5)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (2)
- (3)
- (1)
- (4)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (3)
- (1)
- (3)
- (3)
- (2)
- (4)
- (1)
- (2)
- (3)
- (2)
- (2)
- (2)
- (1)
- (4)
- (3)
- (2)
- (2)
- (3)
- (1)
- (3)
- (1)
- (4)
- (2)
- (2)
- (6)
- (4)
- (7)
- (3)
- (3)
- (2)
- (2)
- (5)
- (4)
- (2)
- (7)
- (1)
- (3)
- (3)
- (3)
- (2)
- (1)
- (2)
- (6)
- (2)
- (4)
- (1)
- (4)
- (2)
- (3)
- (3)
- (3)
- (2)
- (3)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (3)
- (2)
- (1)
- (2)
- (2)
- (1)
- (3)
- (2)
- (5)
- (2)
- (2)
- (1)
- (5)
- (4)
- (2)
- (4)
- (2)
- (3)
- (2)
- (4)
- (3)
- (2)
- (6)
- (2)
- (1)
- (4)
- (6)
- (3)
- (2)
- (7)
- (2)
- (2)
- (3)
- (2)
- (2)
- (4)
- (10)
- (2)
- (1)
- (5)
- (5)
- (2)
- (1)
- (1)
- (2)
- (4)
- (4)
- (2)
- (2)
- (2)
- (4)
- (3)
- (2)
- (2)
- (2)
- (5)
- (4)
- (5)
- (4)
- (3)
- (2)
- (2)
- (2)
- (3)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (3)
- (1)
- (2)
- (3)
- (3)
- (1)
- (3)
- (4)
- (1)
- (2)
- (1)
- (1)
- (3)
- (2)
- (2)
- (7)
- (2)
- (1)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
571
–
585
of
918
results
571
Aobchem 3-(3-Fluorophenoxy)aniline | 97% | CAS 446884-28-2 | C12H10FNO | 1g
3-(3-Fluorophenoxy)aniline | 97% | CAS 446884-28-2 | C12H10FNO | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
572
Aobchem 3-(3-Fluorophenoxy)aniline | 97% | CAS 446884-28-2 | C12H10FNO | 250mg
3-(3-Fluorophenoxy)aniline | 97% | CAS 446884-28-2 | C12H10FNO | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
573
Chembridge Corporation 3-(2-FURYL)ANILINE
[3-(2-furyl)phenyl]amine hydrochloride; CAS: 102269-42-1
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
574
Aobchem 2-(2-Bromophenyl)-1 3 4-oxadiazole | ≥95% | CAS 928722-52-5 | C8H5BrN2O | 5g
2-(2-Bromophenyl)-1 3 4-oxadiazole | ≥95% | CAS 928722-52-5 | C8H5BrN2O | 5g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
575
Medchemexpress LLC Bis(2-methyl-3-furyl)disulfide | 28588-75-2 | 98.4% | 226.31 | 1 G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Bis(2-methyl-3-furyl)disulfide is a chemical compound designed to act as a flavoring agent. It is intended to enhance the natural, fresh, and milk-rich feeling of milk-related products. This product is for research use only.
- Functions as a flavoring compound.
- Enhances natural, fresh, and milk-rich feelings.
- Has a purity of 98.37%.
- Molecular weight is 226.31.
- CAS number is 28588-75-2.
- Recommended storage for pure form: -20°C for 3 years or 4°C for 2 years.
- Recommended storage in solvent: -80°C for 6 months or -20°C for 1 month.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
576
eMolecules 400749-02-2 | 3'-Trifluoromethyl-biphenyl-3-ylamine | Combi-Blocks, Inc. | MFCD03424670 | 237.225 | C13H10F3N | 96.000 | Nc1cccc(c1)-c1cccc(c1)C(F)(F)F | 1g | 603150209
3'-Trifluoromethyl-biphenyl-3-ylamine | Combi-Blocks, Inc. | 400749-02-2 | MFCD03424670 | 237.225 | C13H10F3N | 96.000 | Nc1cccc(c1)-c1cccc(c1)C(F)(F)F | 1g | 603150209
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
577
Aobchem 2-(3-Bromophenyl)-1 3 4-oxadiazole | ≥95% | CAS 5378-34-7 | C8H5BrN2O | 1g
2-(3-Bromophenyl)-1 3 4-oxadiazole | ≥95% | CAS 5378-34-7 | C8H5BrN2O | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
578
Aobchem 3-(Thiophen-3-yl)aniline hydrochloride | ≥97% | CAS 1240529-35-4 | C10H10ClNS | 250mg
3-(Thiophen-3-yl)aniline hydrochloride | ≥97% | CAS 1240529-35-4 | C10H10ClNS | 250mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
579
Aobchem 4-(Furan-2-yl)aniline hydrochloride | ≥97% | CAS 1170462-44-8 | C10H10ClNO | 1g
4-(Furan-2-yl)aniline hydrochloride | ≥97% | CAS 1170462-44-8 | C10H10ClNO | 1g
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
580
Aobchem 2-(3-Fluorophenoxy)aniline | ≥97% | CAS 640766-67-2 | C12H10FNO | 500mg
2-(3-Fluorophenoxy)aniline | ≥97% | CAS 640766-67-2 | C12H10FNO | 500mg
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
581
![Medchemexpress LLC N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) | 64967-39-1 | 99.8% | 399.40 | 50 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000366360-logo.png-250.jpg)
Medchemexpress LLC N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) | 64967-39-1 | 99.8% | 399.40 | 50 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) | 64967-39-1 | 99.8% | 399.40 | 50 MG
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
582
![Medchemexpress LLC N-(3-(aminomethyl)benzyl)-8-(4-benzylpiperazin-1-yl)pyrimido[5,4-d]pyrimidin-4-amine | 1875036-75-1 | >98.0% | 25 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000232153.png-250.jpg)
Medchemexpress LLC N-(3-(aminomethyl)benzyl)-8-(4-benzylpiperazin-1-yl)pyrimido[5,4-d]pyrimidin-4-amine | 1875036-75-1 | >98.0% | 25 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
BI-8626 is a small-molecule inhibitor of the HECT E3 ubiquitin ligase HUWE1, identified by high-throughput screening and reported to inhibit HUWE1 with an IC50 of approximately 0.9 μM. It is supplied for research use only and intended for biochemical and cellular studies.
- Specific HUWE1 inhibitor, IC50 ≈ 0.9 μM.
- Used in biochemical and cellular assays to modulate HUWE1-dependent ubiquitination.
- CAS 1875036-75-1; molecular weight 440.54 g·mol⁻¹.
- Typical reported purity ≥98% (HPLC); verify certificate of analysis per lot.
- Available as solid and as 10 mM solution in DMSO for reconstitution.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
583
Medchemexpress LLC ICCB-19 (hydrochloride) | 1803605-68-6 | 99.3% | 291.84 | C12H22ClN3OS | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
ICCB-19 hydrochloride is a research-grade small molecule that inhibits TRADD-mediated signaling and indirectly inhibits RIPK1 kinase activity. It has been reported to induce autophagy, modulate TNF-induced inflammatory responses, and affect RIPK1-dependent apoptosis in cellular and animal models.
- Targets TRADD and indirectly inhibits RIPK1 kinase activity.
- Binds TRADD N-terminal domain to disrupt protein interactions.
- Promotes autophagy via K63-linked ubiquitination of Beclin-1.
- Reduces TNF-induced inflammatory gene expression in cell and animal studies.
- Provided as a hydrochloride salt with reported high purity.
- Available as solid and DMSO solution aliquots for research use.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
584
Medchemexpress LLC STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | 95.3% | 3649.88 | 5 MG
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
585
eMolecules 1965304-87-3 | 2-(4'-Hydroxy-4-biphenyl)-4,5-diphenylthiazole | Oakwood Chemicals | MFCD28166184 | 405.520 | C27H19NOS | 97.000 | Oc1ccc(cc1)-c1ccc(cc1)-c1nc(c(s1)-c1ccccc1)-c1ccccc1 | 250mg | 480147861
2-(4'-Hydroxy-4-biphenyl)-4,5-diphenylthiazole | Oakwood Chemicals | 1965304-87-3 | MFCD28166184 | 405.520 | C27H19NOS | 97.000 | Oc1ccc(cc1)-c1ccc(cc1)-c1nc(c(s1)-c1ccccc1)-c1ccccc1 | 250mg | 480147861
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More