Phenols
Medchemexpress LLC C-Type Natriuretic Peptide (1-53), human TFA | 141294-77-1 | 99.94% | 5801.77 | 10 MG
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. This natriuretic peptide family peptide is involved in the maintenance of electrolyte-fluid balance and vascular tone.
- Molecular formula: C251H417N81O71S3.xC2HF3O2
- Appearance: Solid
- Color: White to off-white
- Sequence (shortened): DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
- Solubility: H2O: 50 mg/mL (ultrasonic needed)
- Target: Angiotensin receptor
- Pathway: GPCR/G protein
Medchemexpress LLC 2-Chloro-4-methylphenylboronic acid | 145349-62-8 | 170.40 | 10 G
2-Chloro-4-methylphenylboronic acid is intended for laboratory chemical use and for the manufacture of substances. It is stable under recommended storage conditions. The most important known symptoms and effects are described in the labeling.
- Harmful if swallowed.
- Causes serious eye irritation.
- Avoid breathing dust, fume, gas, mist, vapours, or spray.
- Wash hands thoroughly after handling.
- Do not eat, drink, or smoke when using this product.
- Use only outdoors or in a well-ventilated area.
- Wear protective gloves, clothing, and eye/face protection.
- Store in a cool, well-ventilated area, away from direct sunlight and ignition sources.
![Medchemexpress LLC 1,1′,1′′,1′′′-[1,4-Piperazinediylbis(2,1-ethanediylnitrilo)]tetrakis[2-dodecanol] | 1265904-26-4 | 98.0% | 909.54 | 5 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000364400-logo.png-250.jpg){kind=logo}
Medchemexpress LLC 1,1′,1′′,1′′′-[1,4-Piperazinediylbis(2,1-ethanediylnitrilo)]tetrakis[2-dodecanol] | 1265904-26-4 | 98.0% | 909.54 | 5 MG
1,1′,1′′,1′′′-[1,4-Piperazinediylbis(2,1-ethanediylnitrilo)]tetrakis[2-dodecanol] is a lipid/lipidoid used in the preparation of lipid-based or lipidoid nanoparticles. It is intended for research use only.
- Used in the preparation of lipid-based or lipidoid nanoparticles.
- Suitable for biochemical assay reagents.
- Applicable in drug delivery.
- Relevant for metabolic enzyme/protease research.
- Used in liposome research.
Cayman Chemical Anhydrotetracycline hydrochl
A powerful effector in both the TetR and revTetR transcriptional regulator systems, binding the Tet repressor 35-fold more strongly than Tet; does not act a general inhibitor of translation and is a poor antibiotic
Medchemexpress LLC Atrial natriuretic peptide (3-28) (human) | 102686-43-1 | 99.7% | 2880.21 | 1 MG
Atrial natriuretic peptide (3-28) (human) is a peptide hormone synthesized and secreted by the atrial myocardium. It plays a role in the regulation of blood pressure, fluid balance, and electrolyte homeostasis.
- Regulates blood pressure
- Affects fluid balance
- Influences electrolyte homeostasis
Medchemexpress LLC 5'-ODMT cEt N-Bz A Phosphoramidite (Amidite) | 1197033-19-4 | 98.6% | 899.97 | 50 MG
5'-ODMT cEt N-Bz A Phosphoramidite (Amidite) is a nucleoside phosphoramidite monomer for synthesizing locked nucleic acid (LNA) analog oligonucleotides. It serves as a building block for antisense oligonucleotides (ASOs) to target complementary RNA sequences.
- Locks the furanose ring into an N-type conformation through 2',4'-constrained ethyl (cEt) modification
- Enhances hybridization affinity and mismatch discrimination with RNA
- Significantly improves the resistance of oligonucleotides to exonuclease digestion
- Mediates RNase H-dependent mRNA degradation or inhibits translation
- Primarily used in the development of antisense drugs, gene function research, and oligonucleotide synthesis
Medchemexpress LLC 4-hydroxybenzaldehyde | 123-08-0 | MFCD00006939 | 100.0% | 122.12 g/mol | C7H6O2 | 50g
p-Hydroxybenzaldehyde is a one of the major components in vanilla aroma with antagonistic effect on GABAA receptor of the 1 2 2S subtype at high concentrations
Cambridge Isotope Laboratories 1 2 3 7 8-Pentabromodibenzo-p-dioxin (13C12 99%) 5 ug/mL in nonane 1 2 mL
1 2 3 7 8-Pentabromodibenzo-p-dioxin (13C12 99%) 5 ug/mL in nonane 1 2 mL
Medchemexpress LLC P-SCN-Bn-deferoxamine | 1222468-90-7 | 98.0% | 752.94 g/mol | C33H52N8O8S2 | 5 MG
p-SCN-Bn-deferoxamine is a bifunctional chelator designed for bioconjugation and radiolabeling workflows. It couples to primary amines on proteins via a para-isothiocyanatobenzyl (p-SCN-Bn) reactive group and provides a deferoxamine chelator for binding radiometals, enabling preparation of antibody-based tracers and surface-functionalized biomaterials.
- Reacts with primary amines via isothiocyanate chemistry.
- Chelates radiometals for stable radiolabeling.
- Suitable for antibody conjugation and PET tracer development.
- Supplied as a white to off-white solid with high purity.
- Stable when stored protected from light at recommended temperatures.
TARGETMOL CHEMICALS INC 3-O-p-Coumaroylquinic acid 1MG
Also available in 1 mL, 5 mg, 10 mg, 25 mg, 50 mg and bulk. Please contact Fisher for quotes. 3-O-p-Coumaroylquinic acid, hydroxycinnamic acid derivative, is isolated from a 70% methanolic Crataegus extract (Crataegi folium cum flore). Purity 99.81%
Cambridge Isotope Laboratories p-n-Nonylphenol (unlabeled) 100 ug/mL in nonane 1 2 mL
p-n-Nonylphenol (unlabeled) 100 ug/mL in nonane 1 2 mL
Medchemexpress LLC 2,4,6-trimethylphenol | 527-60-6 | MFCD00002235 | 99.5% | 136.19 g/mol | C9H12O | 500 MG
2,4,6-Trimethylphenol is an aromatic phenol used as a probe compound in research; it reacts mainly with organic matter (3DOM) and is rapidly oxidized by singlet oxygen in aqueous solution. For research use only.
- Probe compound for studies of organic matter reactivity (3DOM).
- Undergoes rapid oxidation by singlet oxygen in aqueous environments.
- High reported purity: 99.48% (data sheet) and 99.98% (documentation).
- Molecular formula C9H12O; molecular weight 136.19 g/mol.
- Solubility: DMSO 100 mg/mL (in vitro); formulatable for in vivo dosing at ≥ 2.5 mg/mL in various vehicles.
- Storage: store at 4°C under nitrogen; in solvent: -80°C (6 months) or -20°C (1 month).
Medchemexpress LLC 4-hydroxybenzaldehyde | 123-08-0 | MFCD00006939 | 100.0% | 122.12 g/mol | C7H6O2 | 1kg
p-Hydroxybenzaldehyde is a one of the major components in vanilla aroma with antagonistic effect on GABAA receptor of the 1 2 2S subtype at high concentrations
Medchemexpress LLC P-CAB agent 2 | 1978371-23-1 | C22H25FN2O4S | 5 MG
P-CAB agent 2 is a potent and orally active potassium-competitive acid blocker and a gastric acid secretion inhibitor. It inhibits H+/K+-ATPase activity and shows no acute toxicity.
- Inhibits H+/K+-ATPase activity with an IC50 value of <100 nM.
- Inhibits the hERG potassium channel with an IC50 value of 18.69 μM.
- Shows no acute toxicity.
- Inhibits histamine-induced gastric acid secretion.
Medchemexpress LLC N-(4-phenyl-1,2,3,4-tetrahydronaphthalen-2-yl)propanamide | 134865-74-0 | MFCD00901545 | >99.0% | 279.38 g/mol | C19H21NO | 100 MG
4-P-PDOT is an analytical standard of a selective melatonin MT2 receptor antagonist used as a reference compound in pharmacology and analytical research. It is supplied as a high-purity solid for characterization, assay development, and receptor pharmacology studies.
- Analytical standard for research and assay calibration.
- Selective MT2 melatonin receptor antagonist.
- High purity (>99.0%).
- Molecular formula C19H21NO.
- Molecular weight 279.38 g/mol.
- Provided as a 100 MG solid.
- CAS number 134865-74-0.