Wrenches
Hand tool used to provide grip and mechanical advantage in applying torque for tightening or loosening nuts and bolts. Common styles include open-end, box-end, socket, hex, and combination.
Material
- (1)
- (1,410)
- (6)
- (35)
- (7)
- (10)
- (1)
Product Type
- (2)
- (84)
- (4)
- (99)
- (205)
- (83)
- (95)
- (10)
- (1)
- (30)
- (19)
- (4)
- (102)
- (3)
- (5)
- (3)
- (8)
- (91)
- (1)
- (3)
- (2)
- (2)
- (1)
- (2)
- (10)
- (200)
- (109)
- (14)
- (102)
Drive Size
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (114)
- (3)
- (1)
- (2)
- (2)
- (4)
- (4)
- (1)
- (1)
- (2)
- (4)
- (1)
- (1)
- (2)
- (4)
- (4)
- (1)
- (1)
- (2)
- (1)
- (4)
- (4)
- (1)
- (2)
- (1)
- (4)
- (1)
- (4)
- (2)
- (4)
- (1)
- (4)
- (184)
- (1)
- (2)
- (2)
- (1)
- (56)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (4)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (2)
- (2)
- (1)
- (1)
- (3)
- (3)
- (1)
- (1)
- (1)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (2)
- (3)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (4)
- (3)
- (2)
- (2)
- (2)
- (1)
- (1)
- (4)
- (3)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (5)
- (4)
- (1)
- (4)
- (1)
- (4)
- (1)
- (4)
- (1)
- (3)
- (4)
- (4)
- (4)
- (1)
- (4)
- (4)
- (3)
- (1)
- (4)
- (1)
- (4)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (4)
- (1)
- (2)
- (2)
- (2)
- (1)
- (4)
- (2)
- (3)
- (2)
- (3)
- (2)
- (2)
- (1)
- (4)
- (1)
- (1)
- (4)
- (2)
- (2)
- (4)
- (4)
- (4)
- (2)
- (3)
- (4)
- (2)
- (2)
- (2)
- (2)
- (1)
- (233)
- (2)
- (56)
- (2)
- (4)
- (3)
- (1)
- (3)
- (1)
- (2)
- (4)
- (3)
- (4)
- (1)
- (1)
- (4)
- (4)
- (3)
- (4)
- (3)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (4)
- (2)
- (4)
- (1)
- (1)
- (4)
- (2)
- (4)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (3)
- (1)
- (2)
- (4)
- (2)
- (2)
- (1)
- (4)
- (4)
- (4)
- (2)
- (4)
- (1)
- (2)
- (1)
- (3)
- (1)
- (4)
- (1)
- (4)
- (4)
- (2)
- (4)
- (1)
- (2)
- (1)
- (1)
- (1)
- (4)
- (2)
- (2)
- (4)
- (2)
- (4)
- (4)
- (4)
- (1)
- (1)
- (3)
- (2)
- (4)
- (4)
- (2)
- (2)
- (1)
- (1)
- (3)
- (3)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
Length (Metric)
- (8)
- (2)
- (8)
- (2)
- (8)
- (1)
- (1)
- (8)
- (7)
- (1)
- (6)
- (5)
- (2)
- (7)
- (1)
- (8)
- (1)
- (10)
- (1)
- (8)
- (1)
- (1)
- (2)
- (1)
- (10)
- (10)
- (3)
- (10)
- (10)
- (1)
- (2)
- (10)
- (2)
- (2)
- (2)
- (8)
- (2)
- (8)
- (8)
- (8)
- (3)
- (8)
- (1)
- (1)
- (1)
- (7)
- (8)
- (2)
- (4)
- (3)
- (5)
- (4)
- (1)
- (3)
- (5)
- (4)
- (1)
- (5)
- (2)
- (2)
- (2)
- (1)
- (2)
- (5)
- (1)
- (6)
- (6)
- (2)
- (3)
- (2)
- (2)
- (1)
- (6)
- (1)
- (2)
- (3)
- (1)
- (1)
- (2)
- (2)
- (4)
- (2)
- (1)
- (1)
- (2)
- (2)
- (4)
- (2)
- (2)
- (2)
- (3)
- (14)
- (2)
- (4)
- (4)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (1)
- (8)
- (2)
- (2)
- (8)
- (2)
- (1)
- (1)
- (2)
Length (English)
- (3)
- (1)
- (1)
- (3)
- (9)
- (9)
- (9)
- (6)
- (6)
- (6)
- (1)
- (6)
- (9)
- (3)
- (1)
- (9)
- (1)
- (11)
- (1)
- (1)
- (6)
- (9)
- (8)
- (1)
- (6)
- (5)
- (1)
- (2)
- (4)
- (2)
- (7)
- (2)
- (1)
- (3)
- (2)
- (9)
- (2)
- (1)
- (9)
- (1)
- (1)
- (4)
- (2)
- (1)
- (3)
- (2)
- (6)
- (2)
- (6)
- (6)
- (2)
- (2)
- (6)
- (2)
- (6)
- (6)
- (2)
- (2)
- (2)
- (6)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (4)
- (1)
- (2)
- (9)
- (7)
- (3)
- (2)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (5)
- (6)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (7)
- (2)
- (9)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (8)
- (2)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
91
–
105
of
2,592
results
91
Invitrogen™ Human alpha-1d Adrenoceptor (aa 502-569) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human alpha-1 d Adrenoceptor (aa 502-569) Control Fragment |
| Recombinant | Recombinant |
92
Ampco Safety Tools Standard Socket, 3/8 in. Drive (Metric)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
AMPCO™ Standard Socket performs in high-risk and demanding environments.
| Product Type | Standard Socket Wrench |
|---|---|
| Material | Aluminum Bronze |
| Certifications/Compliance | Factory Mutual (FM) Approved |
| Drive Size | 3/8 in. |
93
Ampco 3/4 in. Ratchet Wrench
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Non-sparking, non-magnetic, corrosion-resistant wrench. Made in the USA.
94
Ampco Safety Tools Double Box Wrench (Imperial)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
AMPCO™ Double Box Wrench performs in high-risk and demanding environments.
| Product Type | Double Box Wrench |
|---|---|
| Material | Aluminum Bronze |
95
Ampco Large Adjustable Wrench Hook Spanner
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Non-sparking, non-magnetic, and corrosion-resistant spanner wrench. Made in the USA.
96
Ampco Chain Pipe Wrench
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Non-sparking, non-magnetic, and corrosion-resistant wrench. Made in the USA.
| Product Type | Chain Pipe Wrench |
|---|---|
| No. per Pack | 1 Ea. |
97
Ampco Safety Tools Hex Key Kit
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
98
Ampco Safety Tools Double Box Wrench (Metric)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
AMPCO™ Double Box Wrench performs in high-risk and demanding environments.
| Product Type | Double Box Wrench |
|---|---|
| Material | Aluminum Bronze |
| Certifications/Compliance | Factory Mutual (FM) Approved |
99
Ampco Safety Tools Box End Wrench (Imperial)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
AMPCO™ Box End Wrench performs in high-risk and demanding environments.
| Product Type | Box End Wrench |
|---|---|
| Material | Aluminum Bronze |
| Certifications/Compliance | Factory Mutual (FM) Approved |
100
Ampco 7/16 in. Tip Insulated Non-Sparking Wrench
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Insulated, non-magnetic, corrosion-resistant, and non-sparking wrench. Made in the USA.
101
Ampco 7/16 in. Insulated Socket
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Insulated, non-sparking, non-magnetic, and corrosion-resistant socket. 1000 V rated and made in the USA.
102
Ampco Safety Tools Impact Socket, 1/2 in. Drive (Imperial)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
AMPCO™ Impact Socket performs in high-risk and demanding environments.
| Product Type | Impact Socket Wrench |
|---|---|
| Material | Aluminum Bronze |
| Certifications/Compliance | Factory Mutual (FM) Approved |
| Drive Size | 1/2 in. |
103
Ampco 6-Point Standard Impact 9/16 in. Socket
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Non-sparking, non-magnetic, corrosion resistant standard impact socket. Made in the USA.
104
Ampco Safety Tools Impact Socket, 3/4 in. Drive (Imperial)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
AMPCO™ Impact Socket performs in high-risk and demanding environments.
| Product Type | Impact Socket Wrench |
|---|---|
| Material | Aluminum Bronze |
| Certifications/Compliance | Factory Mutual (FM) Approved |
| Drive Size | 3/4 in. |
105
Ampco Large Insulated Wrench
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Insulated, non-sparking, and corrosion-resistant sock wrench.