Sera
Cayman Chemical 7-MethylgunosIn 100mg
A methylated form of guanosine; an RNA modification that is present in the 5’-terminal cap of mRNA, as well as in tRNA; has been used as a substrate to measure the activity of PNP; urinary levels are decreased in patients with prostate cancer
Cayman Chemical C4 CeramIded18 14 0 100mg
A bioactive sphingolipid; inhibits IL-4 production by 16% in PMA-stimulated EL4 T cells at 10 μM; cytotoxic to SK-BR-3 and MCF-7/Adr breast cancer cells (IC50s = 15.9 and 19.9 μM, respectively); increases maturation and stability of F508del-CFTR proteins, enhances cAMP-activated chloride secretion, and suppresses secretion of IL-8 in primary epithelial cells isolated from patients with cystic fibrosis
Biolegend LEGENDplexTM Mouse Immune Chec
LEGENDplex Mouse Immune Checkpoint Panel 1 (12-plex) w/VbP Reactivity Mouse Apps Multiplex - Panel Size 100 tests
Cayman Chemical FlunIsolIde 50mg
A fluorinated corticosteroid receptor agonist; induces reversible pyloric hyalinization in CD-1 mice following oral administration at a dose of 200 μg/kg per day
Cayman Chemical ConIvaptnhydrochlorIde 50mg
A vasopressin V1A and V2 receptor antagonist (Kis = 0.48 and 3.04 nM for rat liver V1A and kidney V2, respectively); competitively inhibits oxytocin binding to rat uterine oxytocin receptors (Ki = 44 nM) but has no effect on AVP binding to anterior pituitary V1B receptors at concentrations up to 100 μM in a radioligand binding assay; suppresses AVP-induced increases in intracellular calcium in VSMCs and the pressor response in pithed rats; increases urine output and decreases urine osmolality in dehydrated conscious rats in a dose-dependent manner; reduces brain edema and blood-brain barrier disruption in a mouse experimental stroke model
American Research Products Inc Mouse complement fragment 3b
Mouse complement fragment 3b (C3b) ELISA kit from CUSABIO Detection Range 0 235 ng/mL-15 ng/mL Sensitivity 0 059 ng/mL Sample serum plasma tissue homogenates Method Sandwich
Cayman Chemical EP4 ReceptrC-Term BlockIn 1ea
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.
Cayman Chemical In vItro Screeng for DrugI 96
A RIPK1 inhibitor (IC50s 16 and 2500 nM for the human and mouse enzymes respectively) 10000-fold selective for RIPK1 over a panel of 339 kinases at 10 UM inhibits necrotic cell death induced by a combination of TNF-a and the caspase inhibitor QVD-OPh in U937 human monocytic and L929 murine fibrosarcoma cells (IC50s 6 3 and 1300 nM respectively) decreases IL-1B and IL-6 levels in intestinal mucosa tissue isolated from patients with ulcerative colitis at 3-300 nM increases survival in a mouse model of TNF-a-induced lethal shock at 3 10 and 50 mg/kg