Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

721 – 735 of 1,659,610 results

721

Invitrogen™ V5 Tag Monoclonal Antibody (2F11F7), Alexa Fluor™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Tag
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	V5 Tag
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	simian virus 5 antibody; SPV5gp2; sv5; V5; v-5; V5 Epitope Tag
Product Type	Antibody
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	V5 synthetic peptide: Gly-Lys-Pro-Ile-Pro-Asn-Pro-Leu-Leu-Gly-Leu-Asp-Ser-Thr.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2F11F7

722

Invitrogen™ Aggrecan Monoclonal Antibody (BC-3)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Rat,Canine,Rabbit,Bovine,Sheep,Pig,Feline,Horse,Guinea Pig
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P07897, P13608, P16112, Q28343, Q28670, Q29011
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	Aggrecan
Gene Symbols	ACAN
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	ACAN; Agc; Agc1; AGCAN; aggrecan; aggrecan 1; aggrecan 1 (chondroitin sulfate proteoglycan 1, large aggregating proteoglycan, antigen identified by monoclonal antibody A0122); aggrecan core protein; Aggrecan core protein 2; aggrecan CS2 domain; aggrecan epidermal growth factor-like domain-1; aggrecan G2 domain; aggrecan interglobular domain; aggrecan keratan sulfate domain; aggrecan, structural proteoglycan of cartilage; articular cartilage aggrecan precursor; b2b183Clo; cartilage aggregating proteoglycan; cartilage-specific proteoglycan core protein; Chondroitin sulfate proteoglycan 1; chondroitin sulfate proteoglycan core protein 1; cmd; CSPCP; CSPG1; CSPGCP; high density cartilage proteoglycan; large aggregating cartilage proteoglycan core protein; large aggregating proteoglycan; large aggregating proteoglycan, antigen; MSK16; SEDK
Gene	ACAN
Product Type	Antibody
Gene ID (Entrez)	100009079, 100033876, 100731672, 101084542, 176, 280985, 397255, 403828, 443001, 58968
Formulation	PBS with 30% glycerol, 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to human aggrecan ARGSV neoepitope.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	BC-3

723

Invitrogen™ NGAL Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	P80188
Isotype	IgG
Concentration	500 μg/mL
Antigen	NGAL
Gene Symbols	LCN2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	24p3; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; alpha-2-microglobulin-related protein; Alpha-2U globulin-related protein; AW212229; HGNC:6526; HNL; LCN2; lipocalin 2; lipocalin 2 (oncogene 24p3); Lipocalin 24p3; Lipocalin2; Lipocalin-2; migration-stimulating factor inhibitor; MSFI; neutrophil gelatinase-associated lipocalin; NGAL; oncogene 24p3; OTTHUMP00000022240; p25; RP23-161B9.11; secreted inducible protein 24; Siderocalin; Siderocalin LCN2; Sip24; SV-40-induced 24P3 protein; uterocalin
Gene	LCN2
Product Type	Antibody
Gene ID (Entrez)	3934
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E. coli-derived human Lipocalin 2 recombinant protein (Position: Q21-G198).
Classification	Polyclonal
Primary or Secondary	Primary

724

Invitrogen™ S100A10 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P60903
Isotype	IgG
Concentration	0.10 mg/mL
Antigen	S100A10
Gene Symbols	S100A10
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	42C; AA409961; AL024248; Annexin II; annexin II ligand; annexin II ligand, calpactin I, light polypeptide; annexin II tetramer (AIIt) p11 subunit; ANX2L; ANX2LG; Ca[1]; CAL12; Cal1l; calcium binding protein A11 (calgizzarin); calpactin I light chain; Calpactin-1 light chain; cellular ligand of annexin II; CLP11; GP11; MGC111133; MGC133268; Nerve growth factor-induced protein 42C; OTTHUMP00000015270; P PRSS26; p10; p10 protein; P11; p11 subunit; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium binding protein A10 (calgizzarin); S100 calcium binding protein A10 (calpactin); S100 calcium-binding protein A10; S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S-100 related protein, clone 42C; S100a10
Gene	S100A10
Product Type	Antibody
Gene ID (Entrez)	6281
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human S100A10. Recombinant protein control fragment (Product #RP-102006).
Classification	Polyclonal
Primary or Secondary	Primary

725

Invitrogen™ PPAR alpha Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Plant,Insect
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	P23204, P37230, Q07869
Isotype	IgG
Concentration	1.44 mg/mL
Antigen	PPAR alpha
Gene Symbols	PPARA
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	4933429D07Rik; AW742785; hPPAR; I79_022392; MGC2237; MGC2452; Nr1c1; nuclear hormone receptor; nuclear receptor; nuclear receptor subfamily 1 group C member 1; peroxisome proliferative activated receptor alpha; peroxisome proliferative activated receptor, alpha; peroxisome proliferative activated receptor, alpha isoform 1; peroxisome proliferator; peroxisome proliferator activated receptor; peroxisome proliferator activated receptor alpha; peroxisome proliferator-activated nuclear receptor alpha variant 3; peroxisome proliferator-activated receptor alpha; PPAR; PPAR ALPHA; Ppara; PPARALPHA; PPAR-alpha; proliferator-activated receptor alpha; transcription factor belonging to the nuclear receptor superfamily
Gene	PPARA
Product Type	Antibody
Gene ID (Entrez)	19013, 25747, 5465
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of human PPAR alpha. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

726

Invitrogen™ beta Actin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Canine,Sheep,Hamster,Pig,Feline,Horse,Chicken,Drosophila,Drosophila,Bacteria,Frog,C. elegans,Plant
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O18840, O93400, P48975, P60706, P60708, P60709, P60710, P60711, P60713, Q6QAQ1
Isotype	IgG
Concentration	0.45 mg/mL
Antigen	beta Actin
Gene Symbols	ACTB, actb.L
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631
Gene	ACTB
Product Type	Antibody
Gene ID (Entrez)	100033878, 100689477, 101098507, 101844587, 11461, 396526, 398459, 403580, 414396, 443052, 60, 81822
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide encompassing a sequence within the C-terminus region of human beta Actin. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

727

Invitrogen™ PAX2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q02962
Isotype	IgG
Concentration	1 mg/mL
Antigen	PAX2
Gene Symbols	PAX2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography, Protein A
Gene Alias	FSGS7; Opdc; optic disc coloboma; paired box 2; paired box gene 2; paired box homeotic gene 2; paired box protein Pax-2; PAPRS; PAX2; Pax-2
Gene	PAX2
Product Type	Antibody
Gene ID (Entrez)	5076
Formulation	PBS with no preservative
Immunogen	A synthetic peptide corresponding to the C-terminus of the Human PAX2.
Classification	Polyclonal
Primary or Secondary	Primary

728

Invitrogen™ ACACB Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	E9Q4Z2, O00763
Isotype	IgG
Concentration	500 μg/mL
Antigen	ACACB
Gene Symbols	ACACB
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Acacb; Acc2; ACCB; ACC-beta; acetyl-CoA carboxylase 2; acetyl-CoA carboxylase beta; acetyl-Coenzyme A carboxylase 2; acetyl-Coenzyme A carboxylase beta; AI597064; AW743042; Biotin carboxylase; HACC275
Gene	ACACB
Product Type	Antibody
Gene ID (Entrez)	100705, 116719, 32
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
Classification	Polyclonal
Primary or Secondary	Primary

729

Invitrogen™ Myeloperoxidase Monoclonal Antibody (2C7)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P05164
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Myeloperoxidase
Gene Symbols	MPO
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	84 kDa myeloperoxidase; 89 kDa myeloperoxidase; mKIAA4033; MPO; Myeloperoxidase; Myeloperoxidase heavy chain; Myeloperoxidase light chain
Gene	MPO
Product Type	Antibody
Gene ID (Entrez)	4353
Formulation	PBS with 0.09% sodium azide
Immunogen	Human myeloperoxidase.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2C7

730

Lamin B1 Recombinant Rabbit Monoclonal Antibody (10H34L18), Alexa Fluor™ Plus 488, Invitrogen™

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Alexa Fluor Plus 488
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG
Gene Accession No.	P14733, P20700
Concentration	1.0 mg/mL
Antigen	Lamin B1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	0710005A05Rik; ADLD; C-flanking peptide of NPY; CPON; fc06g01; I79_003938; lamin B1; lamin B1 L homeolog; lamin B1 protein; lamin-b; lamin-B1; Lamin-L(I); LMN; LMN2; LMNB; LMNB1; lmnb1 protein; lmnb1.L; MGC111419; Neuropeptide tyrosine; Neuropeptide Y; NPY; NPY02; prepro-neuropeptide Y; pro-neuropeptide Y; PYY4; RATNPY; RATNPY02; unnamed protein product; wu:fc06g01; XELAEV_18007951mg
Gene	Lmnb1
Product Type	Antibody
Gene ID (Entrez)	16906, 4001
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.8
Immunogen	Peptides corresponding to human LAMIN B1 [(aa62-aa79) (aa450-aa467)].
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	10H34L18

731

Phospho-NFkB p65 (Ser529) Recombinant Rabbit Monoclonal Antibody (NFkBp65S529-H3), APC, Invitrogen™

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	APC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG κ
Gene Accession No.	Q04206, Q04207
Antigen	Phospho-NFkB p65 (Ser529)
Gene Symbols	RELA
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	avian reticuloendotheliosis viral (v-rel) oncogene homolog A; EBP-1; I79_021812; MGC131774; NF KB; NFkappaB p65; nf-kappa-b p65; NF-kappa-B p65delta3; NF-kappa-B transcription factor p65; NF-kappaB transcription factor p65 subunit; NFkB; NF-kB p65; NF-kB p65 subunit; nfkb rela; NFKB1; nfkb3; NFkB-p50; nuclear factor; nuclear factor kappa b; nuclear factor kappa B subunit p65; nuclear factor NF-kappa-B p65 subunit; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3; p65; p65 NF kappaB; p65 NF-kappa B; p65 NFkB; P65 transcription factor; putative transcription factor p65 homolog; REL A; rel1; rela; RELA proto-oncogene, NF-kB subunit; rela.L; rela-a; Transcription factor p65; v-rel avian reticuloendotheliosis viral oncogene homolog A; v-rel avian reticuloendotheliosis viral oncogene homolog A L homeolog; v-rel reticuloendotheliosis viral oncogene homolog A; v-rel reticuloendotheliosis viral oncogene homolog A (avian); v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65; XELAEV_18022301mg; Xrel1; xrela
Gene	RELA
Product Type	Antibody
Gene ID (Entrez)	19697, 5970
Formulation	PBS with 0.20% BSA and 0.09% sodium azide
Immunogen	A synthetic phospho-peptide corresponding to residues surrounding Ser529 of human phospho-NFKB p65.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	NFkBp65S529-H3

732

Invitrogen™ XPC Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P51612, Q01831
Isotype	IgG
Concentration	Conc. Not Determined
Antigen	XPC
Gene Symbols	XPC
Regulatory Status	RUO
Gene Alias	DNA repair protein complementing XP-C cells; DNA repair protein complementing XP-C cells homolog; mutant xeroderma pigmentosum group C; NER; p125; RAD4; Xeroderma pigmentosum group C-complementing protein; Xeroderma pigmentosum group C-complementing protein homolog; xeroderma pigmentosum, complementation group C; XP3; XPC; XPC complex subunit, DNA damage recognition and repair factor; XPCC
Gene	XPC
Product Type	Antibody
Gene ID (Entrez)	22591, 7508
Formulation	Whole Serum with 0.05% sodium azide
Immunogen	Two synthetic peptides, individually conjugated to the C-Terminus and N-Terminus respectively of human XPC.
Classification	Polyclonal
Primary or Secondary	Primary

733

Invitrogen™ 4-1BBL (CD137L) Biosimilar Recombinant Monoclonal Antibody

Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Functional Assay,Surface Plasmon Resonance
Form	Lyophilized
Isotype	IgG1
Concentration	1 mg/mL
Antigen	4-1BBL (CD137L) Biosimilar
Regulatory Status	RUO
Purification Method	Protein A
Product Type	Antibody
Formulation	25mM histidine with 8% sucrose, 0.01% Tween 80 and no preservative; pH 6.2
Classification	Recombinant Monoclonal
Primary or Secondary	Primary

734

Invitrogen™ CD141 Monoclonal Antibody (JAA17), Brilliant Ultra Violet™ 805, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Ultraviolet 805
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P07204
Isotype	IgG2a κ
Concentration	5 μL/Test
Antigen	CD141
Gene Symbols	THBD
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AHUS6; AI385582; BDCA3; BDCA-3; CD141; CD141 antigen; DC141; fetomodulin; sCD141; snoRNA MBII-339; soluble CD141; THBD; THPH12; THRM; thrombomdulin; thrombomodulin; thrombomodulin precursor; TM
Gene	THBD
Product Type	Antibody
Gene ID (Entrez)	7056
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	JAA17

735

Invitrogen™ GP130 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P40189, P40190
Isotype	IgG
Concentration	0.1 mg/mL
Antigen	GP130
Gene Symbols	IL6ST
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	5133400A03Rik; AA389424; Ac1055; BB405851; CD130; CD130 antigen; CDW130; D13Ertd699e; EGK_16499; Gp130; gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form; gp130, oncostatin M receptor; GP130-RAPS; IL-6; IL-6 receptor subunit beta; IL-6R subunit beta; IL-6RB; IL-6R-beta; IL6R-beta; IL6ST; interleukin 6 signal transducer; interleukin 6 signal transducer (gp130, oncostatin M receptor); interleukin 6 signal transducer receptor; interleukin receptor beta chain; interleukin-6 receptor subunit beta; Interleukin-6 signal transducer; interleukin-6 signal transducer receptor; membrane glycoprotein; membrane glycoprotein 130; membrane glycoprotein gp130; oncostatin-M receptor subunit alpha
Gene	IL6ST
Product Type	Antibody
Gene ID (Entrez)	25205, 3572
Formulation	PBS with 20% glycerol, 1% BSA and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the Intracellular domain of human CD130. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
47
48
49
50
...
110,641
Next

Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ V5 Tag Monoclonal Antibody (2F11F7), Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Aggrecan Monoclonal Antibody (BC-3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NGAL Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ S100A10 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PPAR alpha Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ beta Actin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PAX2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ACACB Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Myeloperoxidase Monoclonal Antibody (2C7) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Phospho-NFkB p65 (Ser529) Recombinant Rabbit Monoclonal Antibody (NFkBp65S529-H3), APC, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ XPC Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ 4-1BBL (CD137L) Biosimilar Recombinant Monoclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD141 Monoclonal Antibody (JAA17), Brilliant Ultra Violet™ 805, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GP130 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ V5 Tag Monoclonal Antibody (2F11F7), Alexa Fluor™ 488

Invitrogen™ Aggrecan Monoclonal Antibody (BC-3)

Invitrogen™ NGAL Polyclonal Antibody

Invitrogen™ S100A10 Polyclonal Antibody

Invitrogen™ PPAR alpha Polyclonal Antibody

Invitrogen™ beta Actin Polyclonal Antibody

Invitrogen™ PAX2 Polyclonal Antibody

Invitrogen™ ACACB Polyclonal Antibody

Invitrogen™ Myeloperoxidase Monoclonal Antibody (2C7)

Phospho-NFkB p65 (Ser529) Recombinant Rabbit Monoclonal Antibody (NFkBp65S529-H3), APC, Invitrogen™

Invitrogen™ XPC Polyclonal Antibody

Invitrogen™ 4-1BBL (CD137L) Biosimilar Recombinant Monoclonal Antibody

Invitrogen™ CD141 Monoclonal Antibody (JAA17), Brilliant Ultra Violet™ 805, eBioscience™

Invitrogen™ GP130 Polyclonal Antibody