
Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

All Primary Antibodies
(1,250,837)

Primary Antibody Matched Pairs
(4,127)

Protein Interaction Antibody Pairs
(668)

Protein Phosphorylation Antibody Pairs
(55)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1
–
15
of
1,182,750
results
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Mouse,Rat,Monkey |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P08588, P18090, P34971 |
Isotype | IgG |
Concentration | Conc. Not Determined |
Antigen | beta-1 Adrenergic Receptor |
Gene Symbols | ADRB1 |
Regulatory Status | RUO |
Gene Alias | Adrb1; Adrb-1; ADRB1R; adrenergic receptor, beta 1; adrenergic, beta-1-, receptor; adrenoceptor beta 1; B1AR; beta 1-adrenergic receptor beta 1-AR; beta 1-AR; beta-1 adrenergic receptor; Beta-1 adrenoceptor; beta-1 adrenoreceptor; BETA1AR; beta-AR; cardiac beta adrenergic receptor; RATB1AR; RHR |
Gene | ADRB1 |
Product Type | Antibody |
Gene ID (Entrez) | 11554, 153, 24925 |
Formulation | Whole serum with 0.05% sodium azide |
Immunogen | Synthetic peptide corresponding to residues H(394) G D R P R A S G C L A R A G(408) of mouse B1AR. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Mouse,Rat,Canine,Rabbit,Monkey |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Flow Cytometry,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P14211, P15253, P18418, P27797, P28490 |
Isotype | IgG |
Concentration | Conc. Not Determined |
Antigen | Calreticulin |
Gene Symbols | CALR |
Regulatory Status | RUO |
Gene Alias | Autoantigen RO; CABP3; CALBP; calcium-binding protein 3; CALR; calrectulin; calregulin; Calreticulin; calreticulin precursor; cC1qR; CRP55; CRT; CRTC; Endoplasmic reticulum resident protein 60; epididymis secretory sperm binding protein Li 99n; ERp60; FLJ26680; grp60; HACBP; HEL-S-99n; I79_008346; RO; Ro/SS-A Antigen; Sicca syndrome antigen A (autoantigen Ro; calreticulin); SSA |
Gene | CALR |
Product Type | Antibody |
Gene ID (Entrez) | 100009050, 100350417, 12317, 476694, 64202, 811 |
Formulation | Whole serum with 0.05% sodium azide |
Immunogen | Recombinant, human calreticulin protein. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Alpha-Smooth Muscle Actin Monoclonal Antibody (1A4), eFluor™ 660, eBioscience™, Invitrogen™
Mouse Monoclonal Antibody


Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | eFluor 660 |
Applications | Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Isotype | IgG2a κ |
Gene Accession No. | P62736, P62737, P62738 |
Concentration | 0.2 mg/mL |
Antigen | Alpha-Smooth Muscle Actin |
Gene Symbols | ACTA2 |
Regulatory Status | RUO |
Purification Method | Affinity chromatography |
Gene Alias | 0610041G09Rik; AAT6; ACT-4; acta2; acta2.L; acta2.S; actin; Actin Alpha 2 Smooth Muscle Aorta; actin alpha 2, smooth muscle; Actin Vascular Smooth Muscle; actin, alpha 2, smooth muscle, aorta; actin, alpha 2, smooth muscle, aorta L homeolog; actin, alpha 2, smooth muscle, aorta S homeolog; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; ACTSA; ACTVS; alpha actin 2; Alpha Cardiac Actin; alpha smooth muscle actin; alpha-actin; Alpha-actin-2; alpha-cardiac actin; alphaSMA; alpha-SM-actin; alpha-smooth muscle actin; Aortic Smooth Muscle; asma; a-sma; cell growth-inhibiting gene 46 protein; GIG46; Growth Inhibiting Gene 46; hypothetical protein LOC515610; LOW QUALITY PROTEIN: actin, aortic smooth muscle; mymy5; SM actin; sma; SMactin; sm-actin; SMalphaA; smooth muscle; smooth muscle alpha-actin; vascular smooth muscle alpha-actin; wu:fb63d03; XELAEV_18034370mg |
Gene | ACTA2 |
Product Type | Antibody |
Gene ID (Entrez) | 11475, 59, 81633 |
Formulation | PBS with 0.09% sodium azide; pH 7.2 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 1A4 |
Human Midkine Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 5 publications
Human/Mouse Syntaxin 12 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Antibody
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution. |
---|---|
Target Species | Human,Mouse |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Immunohistochemistry |
Form | Lyophilized |
Isotype | IgG |
Gene Accession No. | Q86Y82 |
Antigen | Syntaxin 12 |
Purification Method | Antigen Affinity-purified |
Dilution | Immunohistochemistry 1-15 μg/mL |
Gene Alias | MGC51957, STX12, STX13, STX14, syntaxin 12, syntaxin-12 |
Gene ID (Entrez) | 23673.0 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. |
Immunogen | E.coli-derived recombinant human Syntaxin 12, Met1-Gln200, Accession No. Q86Y82 |
Classification | Polyclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects human Syntaxin 12 in direct ELISAs. Detects human and mouse Syntaxin 12 in immunohistochemistry. |
ULBP-4/RAET1E Antibody (709116) [Alexa Fluor™ 532], Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
OVA257-264 (SIINFEKL) peptide bound to H-2Kb Monoclonal Antibody (eBio25-D1.16 (25-D1.16)), Biotin, eBioscience™, Invitrogen™
Mouse Monoclonal Antibody


Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
---|---|
Target Species | Mouse |
Host Species | Mouse |
Conjugate | Biotin |
Applications | Flow Cytometry,Immunohistochemistry |
Form | Liquid |
Isotype | IgG1 κ |
Concentration | 0.5 mg/mL |
Antigen | OVA257-264 (SIINFEKL) peptide bound to H-2Kb |
Regulatory Status | RUO |
Purification Method | Affinity Chromatography |
Gene Alias | H-2Kb-SIINFEKL; OVA257-264; OVA257-264 H-2Kb; OVA-Kb |
Product Type | Antibody |
Formulation | PBS with 0.09% sodium azide; pH 7.2 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | eBio25-D1.16 (25-D1.16) |
Recoverin Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence |
Form | Purified |
Isotype | IgG |
Research Discipline | Neuroscience, Vision |
Antigen | Recoverin |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gene Alias | cancer associated retinopathy antigen, Protein CAR, RCV1Cancer-associated retinopathy protein, recoverin |
Gene ID (Entrez) | 5957 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1).,, Sequence:, MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
Classification | Polyclonal |
Primary or Secondary | Primary |
Human GLP-1 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°C as supplied. 1 month, 2 to 8°C under sterile conditions after reconstitution. 6 months, -20 to -70°C under sterile conditions after reconstitution. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P01275 |
Antigen | GLP1 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from cell culture supernatant |
Gene Alias | glicentin-related polypeptide, GLP1, glucagon-like peptide 1, GRPP |
Gene ID (Entrez) | 2641 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. |
Immunogen | Human GLP-1 synthetic peptide, Accession # P01275 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Clone | 2622G |
PD-L1 Antibody (2340D) [Janelia Fluor™ 669], Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
GFP Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Chicken Polyclonal Antibody
Invitrogen™ GFP Polyclonal Antibody
Rabbit Polyclonal Antibody


Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | 4°C |
---|---|
Target Species | Tag |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Western Blot,Immunocytochemistry |
Form | Liquid |
Isotype | IgG |
Concentration | 2 mg/mL |
Antigen | GFP |
Regulatory Status | RUO |
Purification Method | IgG fraction |
Gene Alias | GFP; GFP tag; GFP2; green fluorescence; green fluorescent; Turbo eGFP |
Product Type | Antibody |
Formulation | PBS with 5mM sodium azide; pH 7.2 |
Immunogen | The GFP was isolated directly from the jellyfish Aequorea victoria. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Invitrogen™ DNP Monoclonal Antibody (LO-DNP-30)
Rat Monoclonal Antibody


Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -20°C |
---|---|
Target Species | Chemical |
Host Species | Rat |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry |
Form | Liquid |
Isotype | IgE |
Concentration | 1 mg/mL |
Antigen | DNP |
Regulatory Status | RUO |
Purification Method | Purified |
Gene Alias | C6H3N2O4; C6H4N2O5; Dinitrophenol; DNP |
Product Type | Antibody |
Formulation | PBS with 0.1% sodium azide; pH 7.4 |
Immunogen | Synthetic DNP. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | LO-DNP-30 |