accessibility menu, dialog, popup

UserName
Viewing profile as user:

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (1,657,695)
Secondary Antibodies (70,184)
Isotype Controls and Standards (8,527)
Antibody Panels and Kits (1,390)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (2)
  • (972)
  • (191,969)

brands

  • (1)
  • (1)
  • (1)
  • (19,027)
  • (313)
  • (6)
  • (1)
  • (234)
  • (53)
  • (75)
  • (2)
  • (2)
  • (981)
  • (68,367)
  • (8)
  • (60,683)
  • (4)
  • (1)
  • (119)
  • (1)
  • (1,318)
  • (619)
  • (2)
  • (1)
  • (11)
  • (3)
  • (1)
  • (53)
  • (1)
  • (10)
  • (1)
  • (9)
  • (4)
  • (67)
  • (1)
  • (1)
  • (2)
  • (6)
  • (7)
  • (15)
  • (6)
  • (3)
  • (26,491)
  • (500)
  • (19)
  • (3)
  • (1)
  • (9)
  • (3)
  • (2)
  • (1)
  • (4)
  • (212)
  • (59)
  • (1)
  • (6)
  • (1)
  • (132)
  • (5)
  • (31)
  • (1)
  • (11)
  • (2)
  • (1)
  • (13)
  • (4)
  • (31)
  • (1)
  • (21)
  • (3)
  • (14,226)
  • (5)
  • (32,236)
  • (118)
  • (29)
  • (1)
  • (1)
  • (8)
  • (546)
  • (3)
  • (4)
  • (12,580)
  • (1)
  • (1)
  • (3)
  • (1)
  • (74)
  • (3,494)
  • (2)
  • (143)
  • (9)
  • (443)
  • (105)
  • (1)
  • (28,317)
  • (1)
  • (4,236)
  • (1)
  • (1)
  • (1)
  • (17,371)
  • (1)
  • (371)
  • (31,366)
  • (1)
  • (286)
  • (3)
  • (2)
  • (68)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (6)
  • (1)
  • (1)
  • (3)
  • (78)
  • (1)
  • (11)
  • (474)
  • (4)
  • (21,286)
  • (41)
  • (4)
  • (2)
  • (10)
  • (65)
  • (11,065)
  • (1)
  • (1)
  • (1)
  • (7)
  • (2)
  • (9)
  • (8)
  • (2)
  • (22)
  • (3)
  • (4)
  • (357)
  • (1)
  • (1)
  • (1)
  • (2)
  • (18)
  • (24)
  • (2)
  • (39)
  • (9)
  • (51)
  • (1)
  • (2)
  • (1)
  • (4)
  • (1)
  • (91)
  • (521)
  • (115)
  • (14)
  • (52)
  • (13)
  • (13)
  • (1,413)
  • (30)
  • (12)
  • (61)
  • (2)
  • (21)
  • (10)
  • (3)
  • (29)
  • (2)
  • (1)
  • (2)
  • (8)
  • (2)
  • (215)
  • (2)
  • (99)
  • (1)
  • (177)
  • (7)
  • (326)
  • (1)
  • (18)
  • (1)
  • (114)
  • (2,231)
  • (124)
  • (2,515)
  • (1)
  • (57)
  • (13)
  • (3)
  • (1)
  • (990)
  • (1)
  • (2)
  • (1)
  • (1)
  • (2)
  • (9)
  • (129)
  • (1)
  • (1)
  • (5)
  • (3)
  • (3)
  • (1)
  • (1)
  • (1)
  • (9)
  • (9)
  • (1)
  • (1)
  • (243)
  • (1)
  • (2)
  • (2,050)
  • (3)
  • (2)
  • (1)
  • (1)
  • (4)
  • (2)
  • (3)
  • (1)
  • (1)
  • (21)
  • (5)
  • (17)
  • (2)
  • (29)
  • (17)
  • (3)
  • (1)
  • (1)
  • (17)
  • (1)
  • (2)
  • (1)
  • (3)
  • (317)
  • (687)
  • (1)
  • (41)
  • (3)
  • (1)
  • (59)
  • (6)
  • (4)
  • (1)
  • (1)
  • (7)
  • (1)
  • (2)
  • (16,222)
  • (23,987)
  • (78)
  • (1)
  • (3,095)
  • (1)
  • (1)
  • (5)
  • (6)
  • (1)
  • (2)
  • (128)
  • (1)
  • (3)
  • (5)
  • (88)
  • (1)
  • (1)
  • (5)
  • (209)
  • (1,772)
  • (5)
  • (14)
  • (1)
  • (1)
  • (1)
  • (17)
  • (9)
  • (2)
  • (240)
  • (114)
  • (1)
  • (52)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (2)
  • (112)
  • (10,559)
  • (1)
  • (5)
  • (207)
  • (1)
  • (8)
  • (1)
  • (8,919)
  • (1)
  • (2)
  • (6)
  • (25)
  • (3)
  • (151)
  • (10)
  • (2)
  • (3)
  • (4)
  • (11)
  • (8)
  • (8)
  • (3)
  • (6)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (956,131)
  • (2)
  • (13)
  • (1)
  • (2)
  • (30,511)
  • (33)
  • (1)
  • (4)
  • (606)
  • (326)
  • (245)
  • (1)
  • (1)
  • (17)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (3)
  • (1)
  • (2)
  • (1)
  • (35,648)
  • (1)
  • (1)
  • (34)
  • (2)
  • (25)
  • (13,255)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (7)
  • (59)
  • (1)
  • (15)
  • (103,834)
  • (1)
  • (6)
  • (190)
  • (4)
  • (2)
  • (1)
  • (41)
  • (921)
  • (1)
  • (1)
  • (1)
  • (19)
  • (2,609)
  • (2)
  • (1)
  • (4)
  • (4)
  • (2)
  • (3)
  • (5)
  • (925)
  • (447)
  • (1)
  • (9)
  • (3)
  • (4)
  • (1)
  • (7)
  • (1,703)
  • (371)
  • (1)
  • (1)
  • (1)
  • (907)
  • (124)
  • (15,677)
  • (1)
  • (1)
  • (2)
  • (3,209)
  • (4)
  • (7)
  • (1)
  • (2)
  • (2)
  • (1)
  • (9)
  • (12)
  • (1)
  • (10)
  • (1)
  • (8)
  • (4)
  • (1)
  • (43)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (1)
  • (2)
  • (115,196)
  • (9)
  • (1)
  • (62)
  • (3)
  • (1)
  • (11)
  • (1)
  • (1)
  • (2)
  • (4)
  • (2)
  • (7)
  • (3)
  • (3)
  • (10)
  • (8)
  • (1)
  • (36)
  • (2)
  • (34)
  • (563)
  • (1)
  • (3)
  • (1)
  • (2)
  • (1)
  • (1)
  • (10)
  • (11)
  • (3)
  • (1)
  • (1)
  • (2)
  • (40)
  • (7)
  • (1)
  • (19)
  • (917)
  • (2)
  • (4)

special interests

  • (178)
  • (15,260)
  • (163,220)
  • (31)
  • (1,104,807)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (902)
  • (1,758)
  • (4,356)
Show all

Host Species

  • (567)
  • (2,656)
  • (38)
  • (38)
  • (26)
  • (1,858)
  • (726)
Show all

Conjugate

  • (4)
  • (29,233)
  • (9)
  • (1)
  • (44)
  • (2,858)
  • (83)
Show all

Applications

  • (2)
  • (20)
  • (23)
  • (128)
  • (798)
  • (476)
  • (93)
Show all

Target Species

  • (22)
  • (32)
  • (136)
  • (29)
  • (6)
  • (1,451)
  • (130)
Show all

Classification

  • (86)
  • (139)
  • (702,555)
  • (3,641)
  • (11)
  • (687,428)
  • (30,068)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (383)
  • (961)
  • (1,343,905)

Form

  • (2,702)
  • (2,120)
  • (1,655)
  • (20)
  • (10)
  • (1)
  • (21)
Show all

Molecular Weight (g/mol)

  • (1)
  • (3)
  • (1)
  • (2)
  • (1)
  • (7)
  • (2)
Show all

Search Within Results
Keyword Search:
931 – 945 of 1,659,610 results
931

Invitrogen™ TCR V alpha 2 Monoclonal Antibody (F1), FITC
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage 4°C, store in dark
Target Species Human,Monkey
Host Species Mouse
Conjugate FITC
Applications Flow Cytometry
Form Liquid
Isotype IgG2a
Concentration 0.15 mg/mL
Antigen TCR V alpha 2
Regulatory Status RUO
Purification Method Protein A
Gene Alias TCRVA; TCRVA2; V alpha 2; V alpha-2 TCR; Va 2; Va2; Valpha 2; Valpha2
Product Type Antibody
Formulation PBS with 0.5% BSA and 0.1% sodium azide
Immunogen Human TCR V alpha-2.
Classification Monoclonal
Primary or Secondary Primary
Clone F1
932

Invitrogen™ BTLA Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Lyophilized
Gene Accession No. Q7TSA3, Q7Z6A9
Isotype IgG
Concentration 500 μg/mL
Antigen BTLA
Gene Symbols BTLA
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias A630002H24; B and T lymphocyte associated; B and T lymphocyte associated protein; B and T lymphocyte attenuator; B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; BTLA; BTLA_HUMAN; BTLA1; CD272; CD272 antigen; FLJ16065; MGC129743
Gene BTLA
Product Type Antibody
Gene ID (Entrez) 151888, 208154
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL).
Classification Polyclonal
Primary or Secondary Primary
933

Invitrogen™ TCR V alpha 12.1 Monoclonal Antibody (6D6.6)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunoprecipitation,T-Cell Activation,Western Blot
Form Liquid
Isotype IgG1
Concentration 0.15 mg/mL
Antigen TCR V alpha 12.1
Regulatory Status RUO
Purification Method Protein G
Gene Alias TCRVA; TCRVA 12.1; V alpha 12.1; V alpha-12.1 TCR
Product Type Antibody
Formulation PBS with 0.5% BSA and 0.1% sodium azide
Immunogen Human TCR V alpha 12.1.
Classification Monoclonal
Primary or Secondary Primary
Clone 6D6.6
934

Invitrogen™ PD-1 (CD279) Recombinant Rabbit Monoclonal Antibody (RM309)

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. Q15116
Isotype IgG
Concentration 0.5 mg/mL
Antigen PD-1 (CD279)
Gene Symbols Pdcd1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CD279; EGK_05005; hPD1; hPD-1; hPD-l; hSLE1; Ly101; mPD-1; PD1; PD-1; Pdc1; Pdcd1; programmed cell death 1; programmed cell death 1 protein; programmed cell death protein 1; programmed cell death protein 1-like; programmed death 1; Protein PD1; protein PD-1; sCD279; SLEB2; soluble CD279; systemic lupus erythematosus susceptibility 2
Gene Pdcd1
Product Type Antibody
Gene ID (Entrez) 5133
Formulation PBS with 0.09% sodium azide; pH 7.4
Immunogen A peptide corresponding to the N-terminus of human PD-1.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone RM309
935

Invitrogen™ PSD93 Recombinant Rabbit Monoclonal Antibody (7H7L3)

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. Q15700, Q63622, Q91XM9
Isotype IgG
Concentration 0.5 mg/mL
Antigen PSD93
Gene Symbols DLG2
Regulatory Status RUO
Purification Method Protein A
Gene Alias A330103J02Rik; B230218P12Rik; B330007M19Rik; channel-associated protein of synapse-110; channel-associated protein of synapses, 110kDa; Chapsyn-1; chapsyn-110; discs large 2; discs large homolog 2; discs large MAGUK scaffold protein 2; discs, large homolog 2; discs, large homolog 2 (Drosophila); discs, large homolog 2, chapsyn-110; disks large homolog 2; DLG2; Dlgh2; Gm1197; Postsynaptic density protein PSD-93; PPP1R58; protein phosphatase 1, regulatory subunit 58; PSD93; PSD-93; synaptic density protein PSD-93
Gene DLG2
Product Type Antibody
Gene ID (Entrez) 1740, 23859, 64053
Formulation PBS with 0.09% sodium azide; pH 7.2
Immunogen Protein corresponding to Human DLG2 (aa 250-430).
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone 7H7L3
936

Invitrogen™ DNAJC8 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. O75937
Isotype IgG
Concentration 0.05 mg/mL
Antigen DNAJC8
Gene Symbols DNAJC8
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 1110021D09Rik; 2010009J04Rik; AL024084; AU019262; AU044514; DnaJ (Hsp40) homolog, subfamily C, member 8; DnaJ heat shock protein family (Hsp40) member C8; dnaJ homolog subfamily C member 8; DNAJC8; HSPC315; HSPC331; SPF31; splicing protein spf31
Gene DNAJC8
Product Type Antibody
Gene ID (Entrez) 22826
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen Recombinant protein corresponding to Human DNAJC8. Recombinant protein control fragment (Product #RP-94175).
Classification Polyclonal
Primary or Secondary Primary
937

Invitrogen™ DYKDDDDK Tag Monoclonal Antibody (L5)
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Tag
Host Species Rat
Conjugate Unconjugated
Applications ELISA,Western Blot
Form Liquid
Isotype IgG2a
Concentration 1 mg/mL
Antigen DYKDDDDK Tag
Regulatory Status RUO
Purification Method Protein G
Gene Alias DDDDK; DDDDK epitope tag; ECS epitope tag; ECS tag; FLAG; FLAG Tag
Product Type Antibody
Formulation PBS with no preservative
Immunogen Recombinant fusion proteins of mouse Langerin/CD207.
Classification Monoclonal
Primary or Secondary Primary
Clone L5
938

Invitrogen™ PPAP2A Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot
Form Liquid
Gene Accession No. O14494, Q61469
Isotype IgG
Concentration 1 mg/mL
Antigen PPAP2A
Gene Symbols PLPP1
Regulatory Status RUO
Purification Method Protein A
Gene Alias 35 kDa PAP; Hic53; Hpic53; hydrogen peroxide inducible protein 53; Hydrogen peroxide-inducible protein 53; Lipid phosphate phosphohydrolase 1; lipid phosphate phosphohydrolase 1a; LLP1a; Lpp1; LPP-1; magnesium-independent type 2 phosphatidic acid phosphatase; mPAP; PAP2; PAP2A; PAP-2a; PAP2a2; PAP2-alpha; PAP2alpha2; PAPalpha1; phosphatidate phosphohydrolase type 2a; Phosphatidic acid phosphatase 2a; phosphatidic acid phosphatase 2a2; phosphatidic acid phosphatase type 2A; phosphatidic acid phosphohydrolase type 2a; phospholipid phosphatase 1; Plpp1; Ppap2a; PPAP2A; LPP1; type-2 phosphatidic acid phosphatase alpha; Unknown (protein for MGC:133873); WUN
Gene PLPP1
Product Type Antibody
Gene ID (Entrez) 19012, 8611
Formulation PBS with 2% sucrose and 0.09% sodium azide
Immunogen Synthetic peptide directed towards the middle region of human PPAP2A.
Classification Polyclonal
Primary or Secondary Primary
939

Invitrogen™ FOLR2 Monoclonal Antibody (EM-35), PE
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P14207
Isotype IgG1
Concentration 0.1 mg/mL
Antigen FOLR2
Gene Symbols FOLR2
Regulatory Status RUO
Purification Method Size-exclusion chromatography
Gene Alias BETA-HFR; FBP; FBP/PL-1; Fbp2; folate binding protein; folate binding protein 2; folate receptor 2; folate receptor 2 (fetal); folate receptor beta; folate receptor, beta; folate receptor, fetal/placental; Folate-binding protein 2; folate-binding protein, fetal/placental; Folbp2; Folbp-2; FOLR2; FR-beta; FR-P3; placental folate-binding protein
Gene FOLR2
Product Type Antibody
Gene ID (Entrez) 2350
Formulation PBS with 0.2% BSA and 15mM sodium azide; pH 7.4
Immunogen BW5147alpha,beta- cells.
Classification Monoclonal
Primary or Secondary Primary
Clone EM-35
940

Invitrogen™ PARP1 Monoclonal Antibody (C.384.8)
GREENER_CHOICE

Rabbit Monoclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat,Monkey
Host Species Rabbit
Conjugate Unconjugated
Applications ChIP Assay,Immunoprecipitation,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P09874, P11103, P27008
Isotype IgG
Concentration 438 μg/mL
Antigen PARP1
Gene Symbols Parp1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 5830444G22Rik; ADP-ribosyltransferase (NAD+; ADP-ribosyltransferase (NAD+) poly (ADP-ribose) polymerase); ADP-ribosyltransferase (NAD+, poly (ADP-ribose) polymerase) 1; ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase); ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase) 1; ADP-ribosyltransferase 1; ADP-ribosyltransferase diphtheria toxin-like 1; ADP-ribosyltransferase NAD(+); Adprp; Adprt; ADPRT 1; Adprt1; AI893648; ARTD1; C80510; DNA ADP-ribosyltransferase PARP1; I79_014850; msPARP; NAD(+) ADP-ribosyltransferase 1; NAD(+) pADPRT-1; pADPRT-1; PARP; PARP1; PARP-1; poly (ADP-ribose) polymerase 1; poly (ADP-ribose) polymerase family, member 1; poly (ADP-ribose) polymerase); poly [ADP-ribose] polymerase 1; poly ADP-ribose polymerase; poly(ADP-ribose) polymerase; poly(ADP-ribose) polymerase 1; poly(ADP-ribose) polymerase PARP-1; poly(ADP-ribose) synthetase; poly(ADP-ribosyl)transferase; Poly[ADP-ribose] synthase 1; poly[ADP-ribose] synthetase 1; PPOL; Protein poly-ADP-ribosyltransferase PARP1; sPARP-1; synthetase fragment (AA 67); Unknown (protein for IMAGE:8023736); unnamed protein product
Gene Parp1
Product Type Antibody
Gene ID (Entrez) 0, 11545, 142, 25591
Formulation 0.01M HEPES with 0.15M NaCl, 50% glycerol, 100μg/mL BSA and <0.02% sodium azide; pH 7.5
Immunogen Synthetic peptide corresponding to residues surrounding Gly623 of human PARP-1.
Classification Monoclonal
Primary or Secondary Primary
Clone C.384.8
941

Invitrogen™ PSMA1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat,Canine,Hamster
Host Species Rabbit
Conjugate Unconjugated
Applications Immunoprecipitation,Western Blot,RNA Immunoprecipitation,Immunocytochemistry
Form Liquid
Gene Accession No. P18420, P25786, Q9R1P4
Isotype IgG
Concentration 1 mg/mL
Antigen PSMA1
Gene Symbols PSMA1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 20S proteasome subunit C2; 30 kDa prosomal protein; alpha-type; C2; epididymis secretory protein Li 275; HC2; HEL-S-275; macropain subunit C2; macropain subunit nu; MGC14542; MGC14575; MGC14751; MGC1667; MGC21459; MGC22853; MGC23915; multicatalytic endopeptidase complex subunit C2; NU; PROS30; PROS-30; proteasome (prosome, macropain) subunit, alpha type 1; proteasome (prosome, macropain) subunit, alpha type, 1; proteasome 20S subunit alpha 1; proteasome alpha 1 subunit; proteasome component C2; Proteasome nu chain; proteasome subunit alpha 1; Proteasome subunit alpha type-1; proteasome subunit nu; proteasome subunit, alpha-type, 1; protein P30-33K; PSC2; Psma1; testicular tissue protein Li 150
Gene PSMA1
Product Type Antibody
Gene ID (Entrez) 100773907, 26440, 29668, 476867, 5682
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen Synthetic Peptide: C P(249) A D E P A E K A D E P M E H(263).
Classification Polyclonal
Primary or Secondary Primary
942

Invitrogen™ Phospho-c-Myc (Thr58) Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form Liquid
Gene Accession No. P01106
Isotype IgG
Concentration 1 mg/mL
Antigen Phospho-c-Myc (Thr58)
Gene Symbols MYC
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias AU016757; Avian myelocytomatosis viral (v-myc) oncogene homolog; avian myelocytomatosis viral oncogene homolog; bHLHe39; c Myc; class E basic helix-loop-helix protein 39; cmyc; c-Myc; c-myc epitope tag; c-myc proto-oncogene; mMyc; MRTL; Myc; Myc protein; Myc proto-oncogene protein; MYC proto-oncogene, bHLH transcription factor; Myc2; MYCC; myc-related translation/localization regulatory factor; myelocytomatosis oncogene; myelocytomatosis viral oncogene homolog; Niard; Nird; Proto-oncogene c-Myc; RNCMYC; Transcription factor p64; v-myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene-like protein
Gene MYC
Product Type Antibody
Gene ID (Entrez) 4609
Formulation PBS with 50% glycerol and 0.02% sodium azide; pH 7.2
Immunogen Synthetic phosphopeptide derived from human Myc around the phosphorylation site of Threonine 58.
Classification Polyclonal
Primary or Secondary Primary
943

Invitrogen™ Monoacylglycerol Lipase Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. O35678, Q8R431, Q99685
Isotype IgG
Concentration 0.4 mg/mL
Antigen Monoacylglycerol Lipase
Gene Symbols MGLL
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias AA589436; HUK5; HU-K5; lysophospholipase homolog; Lysophospholipase-like; MAGL; Mgl; Mgl2; MGLL; Monoacylglycerol lipase; monoglyceride lipase
Gene MGLL
Product Type Antibody
Gene ID (Entrez) 11343, 23945, 29254
Formulation PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Recombinant protein encompassing a sequence within the center region of human Monoglyceride lipase. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
944

Invitrogen™ Phospho-mTOR (Ser2448) Recombinant Mouse Monoclonal Antibody (MRRBY)

Mouse Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Western Blot
Form Liquid
Gene Accession No. P42345
Isotype IgG2a κ
Concentration 1 mg/mL
Antigen Phospho-mTOR (Ser2448)
Gene Symbols MTOR
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias 2610315D21Rik; AI327068; angiopoietin-like factor CDT6; FK506 binding protein 12-rapamycin associated protein 1; FK506 binding protein 12-rapamycin associated protein 2; FK506-binding protein 12-rapamycin complex-associated protein 1; FKBP12-rapamycin complex-associated protein; FKBP12-rapamycin complex-associated protein 1; FKBP-rapamycin associated protein; FKBP-rapamycin associated protein (FRAP); FKBP-rapamycin-associated protein FRAP; flat; FRAP; FRAP1; FRAP2; Mammalian target of rapamycin; mechanistic target of rapamycin; mechanistic target of rapamycin (serine/threonine kinase); mechanistic target of rapamycin kinase; Mtor; m-TOR; mTORC1; Raft1; Rapamycin and FKBP12 target 1; rapamycin and FKBP12 target-1 protein; rapamycin associated protein FRAP2; rapamycin target protein 1; RAPT1; serine/threonine-protein kinase mTOR; SKS
Gene MTOR
Product Type Antibody
Gene ID (Entrez) 2475
Formulation PBS with 0.09% sodium azide; pH 7.4
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone MRRBY
945

Invitrogen™ Cortactin Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. Q14247, Q60598, Q66HL2
Isotype IgG
Concentration 1 mg/mL
Antigen Cortactin
Gene Symbols Cttn
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 1110020L01Rik; amplaxin; cortactin; Cttn; Cttnb; EMS1; ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 src substrate); FLJ34459; mammary tumor and squamous cell carcinoma associated (p80/85 src substrate); oncogene EMS1; Oncogene SRC8; Src substrate cortactin; src8; Unknown (protein for MGC:137923)
Gene Cttn
Product Type Antibody
Gene ID (Entrez) 13043, 2017, 60465
Formulation PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human Cortactin. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary