All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (158)
- (98)
- (129)
- (404)
- (1)
- (126)
- (362)
- (46,762)
- (1,915)
- (91)
- (4)
- (277)
- (300)
- (142)
- (94)
- (413)
- (610)
- (185)
- (1)
- (14)
- (1)
- (156)
- (343)
- (373)
- (12)
- (122)
- (62)
- (1)
- (90)
- (26)
- (1)
- (15)
- (9,828)
- (31,060)
- (3)
- (698)
- (2,868)
- (17)
- (2)
- (3)
- (2)
- (1)
- (3)
- (1)
- (1)
- (1)
- (288)
- (18)
- (2)
- (25)
- (26)
- (2)
- (861)
- (295)
- (73)
- (1)
- (1)
- (5)
- (369)
- (274)
- (1)
- (3)
- (2)
- (985)
- (10,603)
- (3)
- (1,140)
- (1)
- (1)
- (7)
- (158)
- (2)
- (94)
- (1)
- (2)
- (1)
- (1)
- (1)
- (209)
- (1)
- (1)
- (17)
- (2)
- (15)
- (1)
- (279)
- (1)
- (2)
- (6)
- (399)
- (4,152)
- (88)
- (1)
- (84)
- (2)
- (161)
- (1,844)
- (4)
- (37)
- (1)
- (55)
- (2)
- (1)
- (2)
- (2,591)
- (1)
- (7)
- (238)
- (5)
- (4)
- (26)
- (5)
- (3,210)
- (3,180)
- (1)
- (3,439)
- (2)
- (1,663)
- (5)
- (12)
- (10)
- (3,228)
- (3,688)
- (6)
- (3,332)
- (3,212)
- (18)
- (16)
- (1)
- (20)
- (3)
- (3)
- (3)
- (3)
- (3)
- (1)
- (4,204)
- (1)
- (1)
- (7)
- (33)
- (66)
- (69)
- (75)
- (78)
- (88)
- (86)
- (73)
- (86)
- (39)
- (46)
- (61)
- (67)
- (70)
- (66)
- (67)
- (1,729)
- (1)
- (2)
- (1)
- (20)
- (23)
- (6)
- (1,574)
- (1,578)
- (1,595)
- (1)
- (1,578)
- (1,318)
- (1,702)
- (1,662)
- (1,540)
- (1)
- (1)
- (1)
- (2,245)
- (2)
- (327)
- (56)
- (1,626)
- (1,747)
- (1,446)
- (1,069)
- (1,070)
- (1,431)
- (1,753)
- (4)
- (1)
- (7)
- (1)
- (5)
- (3)
- (7)
- (15)
- (3)
- (4)
- (8)
- (2)
- (6)
- (10)
- (4)
- (6)
- (10)
- (11)
- (4)
- (6)
- (2)
- (10)
- (10)
- (6)
- (8)
- (4)
- (14)
- (9)
- (1)
- (9)
- (5)
- (8)
- (10)
- (41)
- (2,123)
- (1)
- (17)
- (34)
- (227)
- (293)
- (11)
- (18)
- (202)
- (8)
- (4)
- (1,657)
- (48)
- (51)
- (2)
- (3)
- (1)
- (854)
- (30)
- (14)
- (48)
- (51)
- (34)
- (25)
- (58)
- (4)
- (44)
- (62)
- (44)
- (48)
- (46)
- (40)
- (46)
- (42)
- (3)
- (25)
- (21)
- (10)
- (8)
- (9)
- (35)
- (3)
- (48,080)
- (2)
- (11)
- (7)
- (40)
- (8)
- (6)
- (4)
- (28)
- (1,634)
- (1,629)
- (2,043)
- (6)
- (9)
- (69,587)
- (2)
- (48,421)
- (2,264)
- (6)
- (56)
- (23)
- (166)
- (155)
- (5)
- (11,913)
- (4)
- (9)
- (312)
- (1,092)
- (2)
- (5)
- (2)
- (30)
- (1)
- (48,686)
- (3)
- (43,092)
- (10,544)
- (4,270)
- (6)
- (2)
- (2)
- (7)
- (102)
- (94)
- (11)
- (20)
- (3)
- (709)
- (209)
- (12)
- (3)
- (589)
- (14)
- (85)
- (15)
- (9)
- (4)
- (1)
- (1)
- (11)
- (2)
- (7,948)
- (8)
- (17)
- (28)
- (269)
- (48)
- (2)
- (25,826)
- (726)
- (720)
- (503)
- (7)
- (2)
- (4)
- (29)
- (41,069)
- (51)
- (602)
- (2)
- (887)
- (10)
- (2)
- (6)
- (69)
- (480)
- (1)
- (5)
- (10)
- (2)
- (2)
- (3)
- (438)
- (790)
- (18,479)
- (4,600)
- (6)
- (2)
- (12,129)
- (28,729)
- (89)
- (3,085)
- (1)
- (5)
- (1,171)
- (23,665)
- (14)
- (21)
- (24)
- (8,969)
- (61)
- (1)
- (5)
- (49)
- (16)
- (126)
- (21)
- (131)
- (1)
- (783)
- (9)
- (5)
- (19)
- (2)
- (21)
- (59)
- (10)
- (36)
- (18)
- (4,586)
- (11)
- (11)
- (160)
- (113)
- (686)
- (74)
- (11)
- (336)
- (152)
- (86)
- (67)
- (42)
- (1)
- (451)
- (43)
- (31)
- (6)
- (1)
- (75)
- (24)
- (4)
- (6)
- (66,601)
- (252)
- (1)
Filtered Search Results
Invitrogen™ IL-6 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Western Blot |
| Form | Liquid |
| Gene Accession No. | P05231, P08505, P20607 |
| Isotype | IgG |
| Concentration | 0.72 mg/mL |
| Antigen | IL-6 |
| Gene Symbols | Il6 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | B-cell differentiation factor; B-cell hybridoma growth factor; B-cell stimulatory factor 2; BSF2; BSF-2; CDF; CHIL-6; CTL differentiation factor; cytokine; HGF; H-IL-6; HSF; hybridoma growth factor; Ifnb2; IFN-beta-2; Il6; IL-6; ILg6; ILN; interferon beta-2; Interleukin; interleukin 6; Interleukin 6 (interferon, beta 2); interleukin 6 precursor; interleukin BSF-2; interleukin HP-1; Interleukin6; Interleukin-6; interleukin-6 precursor; interleukin-6 protein; M-IL-6; prointerleukin 6; R-IL-6 |
| Gene | Il6 |
| Product Type | Antibody |
| Gene ID (Entrez) | 16193, 24498, 3569 |
| Formulation | PBS with 20% glycerol and 0.025% ProClin 300 |
| Immunogen | Full length human IL6 Recombinant protein. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ IL-6 Monoclonal Antibody (7IL6), Biotin
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | ELISA,Western Blot |
| Form | Liquid |
| Gene Accession No. | P05231 |
| Isotype | IgG1 |
| Concentration | 0.5 mg/mL |
| Antigen | IL-6 |
| Gene Symbols | Il6 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | B-cell differentiation factor; B-cell hybridoma growth factor; B-cell stimulatory factor 2; BSF2; BSF-2; CDF; CHIL-6; CTL differentiation factor; cytokine; HGF; H-IL-6; HSF; hybridoma growth factor; Ifnb2; IFN-beta-2; Il6; IL-6; ILg6; ILN; interferon beta-2; Interleukin; interleukin 6; Interleukin 6 (interferon, beta 2); interleukin 6 precursor; interleukin BSF-2; interleukin HP-1; Interleukin6; Interleukin-6; interleukin-6 precursor; interleukin-6 protein; M-IL-6; prointerleukin 6; R-IL-6 |
| Gene | Il6 |
| Product Type | Antibody |
| Gene ID (Entrez) | 3569 |
| Formulation | PBS with 4% BSA and proprietary Preservative |
| Immunogen | Recombinant human IL-6. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 7IL6 |
Frizzled-6 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 1 publication
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Gene Accession No. | O60353 |
| Research Discipline | GPCR, Growth and Development, Neuronal Cell Markers, Signal Transduction, Wnt Signaling Pathway |
| Antigen | Frizzled-6 |
| Gene Symbols | FZD6 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Gene Alias | frizzled (Drosophila) homolog 6, frizzled homolog 6 (Drosophila), frizzled-6, fz-6, FZ6, HFZ6, seven transmembrane helix receptor |
| Gene ID (Entrez) | 8323 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Human Integrin beta 6 APC-conjugated Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Frizzled-6 Rabbit anti-Human, Mouse, Rat, Polyclonal, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunofluorescence |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | GPCR, Growth and Development, Neuronal Cell Markers, Signal Transduction, Wnt Signaling Pathway |
| Concentration | 1 mg/ml |
| Antigen | Frizzled-6 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence |
| Gene Alias | frizzled (Drosophila) homolog 6, frizzled homolog 6 (Drosophila), frizzled-6, fz-6, FZ6, HFZ6, seven transmembrane helix receptor |
| Gene ID (Entrez) | 8323 |
| Formulation | PBS |
| Immunogen | Antibody was raised against a peptide corresponding to 14 amino acids in the central domain of human Frizzled-6. The immunogen is located within 50-550 amino acids of Frizzled-6. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Glucose 6 Phosphate Dehydrogenase Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cancer, Cellular Markers, Golgi Apparatus Markers |
| Antigen | Glucose 6 Phosphate Dehydrogenase |
| Regulatory Status | RUO |
| Purification Method | Immunogen affinity purified |
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Gene Alias | G6PD, G6PD1EC 1.1.1.49, glucose-6-phosphate dehydrogenase |
| Gene ID (Entrez) | 2539 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKP |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Glucose 6 Phosphate Dehydrogenase Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 3 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Gene Accession No. | P11413 |
| Research Discipline | Cancer, Cellular Markers, Golgi Apparatus Markers |
| Antigen | Glucose 6 Phosphate Dehydrogenase |
| Gene Symbols | G6PD |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Molecular Weight of Antigen | 59 kDa |
| Gene Alias | G6PD, G6PD1EC 1.1.1.49, glucose-6-phosphate dehydrogenase |
| Gene ID (Entrez) | 2539 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALH |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Glucose 6 Phosphate Dehydrogenase Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 17 publications
| Antigen | Glucose 6 Phosphate Dehydrogenase |
|---|---|
| Regulatory Status | RUO |
| Content And Storage | Store at 4C. Do not freeze. |
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunoblot,Immunohistochemistry,Immunohistochemistry (Frozen),Western Blot |
| Gene ID (Entrez) | 2539 |
| Classification | Polyclonal |
| Immunogen | The immunogen recognized by this antibody maps to a region between residues 50 and 100 of human Glucose-6-Phosphate Dehydrogenase using the numbering given in entry NP_000393.2 (GeneID 2539). |
| Primary or Secondary | Primary |
BMPR-IB/ALK-6 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Human/Mouse BMPR-IB/ALK-6 Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody has been used in 7 publications
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG2a |
| Antigen | BMPR-IB/ALK-6 |
| Gene Symbols | BMPR1B |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified from ascites |
| Dilution | Western Blot 1 ug/mL |
| Gene Alias | activin receptor-like kinase 6, ALK-6, ALK6CDw293, BMP type-1B receptor, BMPR1B, BMPR-1B, BMPRIB, bone morphogenetic protein receptor type-1B, bone morphogenetic protein receptor, type IB, CDw293, CDw293 antigen, EC 2.7.11, EC 2.7.11.30, serine/threonine receptor kinase |
| Gene ID (Entrez) | 658 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human BMPR-IB/ALK-6 |
| Classification | Monoclonal |
| Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Primary or Secondary | Primary |
| Test Specificity | Detects human and mouse BMPR-IB/ALK-6 in direct ELISAs and Western blots. In direct ELISAs and Western blots, 100% cross-reactivity with recombinant mouse (rm) BMPR-IB and no cross-reactivity with recombinant human (rh) BMPR-IA, rmBMPR-IA, or rhBMPR-II is observed. |
| Clone | 88614 |
BMPR-IB/ALK-6 Antibody [PE], Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Goat Polyclonal Antibody
| Content And Storage | Store at 4°C in the dark. |
|---|---|
| Target Species | Human |
| Host Species | Goat |
| Conjugate | PE |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Mesenchymal Stem Cell Markers, Protein Kinase, Stem Cell Markers |
| Antigen | BMPR-IB/ALK-6 |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity-purified |
| Gene Alias | activin receptor-like kinase 6, ALK-6, ALK6CDw293, BMP type-1B receptor, BMPR-1B, bone morphogenetic protein receptor type-1B, bone morphogenetic protein receptor, type IB, CDw293 antigen, EC 2.7.11, EC 2.7.11.30, serine/threonine receptor kinase |
| Gene ID (Entrez) | 658 |
| Formulation | PBS |
| Classification | Polyclonal |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human BMPR-IB/ALK-6, Lys14-Arg126, Accession # O00238 |
| Primary or Secondary | Primary |
BMPR-IB/ALK-6 Antibody [PerCP], Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Goat Polyclonal Antibody
| Content And Storage | Store at 4°C in the dark. |
|---|---|
| Target Species | Human |
| Host Species | Goat |
| Conjugate | PerCP |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Mesenchymal Stem Cell Markers, Protein Kinase, Stem Cell Markers |
| Antigen | BMPR-IB/ALK-6 |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity-purified |
| Gene Alias | activin receptor-like kinase 6, ALK-6, ALK6CDw293, BMP type-1B receptor, BMPR-1B, bone morphogenetic protein receptor type-1B, bone morphogenetic protein receptor, type IB, CDw293 antigen, EC 2.7.11, EC 2.7.11.30, serine/threonine receptor kinase |
| Gene ID (Entrez) | 658 |
| Formulation | PBS |
| Classification | Polyclonal |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human BMPR-IB/ALK-6, Lys14-Arg126, Accession # O00238 |
| Primary or Secondary | Primary |
BMPR-IB/ALK-6 Antibody [FITC], Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Goat Polyclonal Antibody
| Content And Storage | Store at 4°C in the dark. |
|---|---|
| Target Species | Human |
| Host Species | Goat |
| Conjugate | FITC |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Mesenchymal Stem Cell Markers, Protein Kinase, Stem Cell Markers |
| Antigen | BMPR-IB/ALK-6 |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity-purified |
| Gene Alias | activin receptor-like kinase 6, ALK-6, ALK6CDw293, BMP type-1B receptor, BMPR-1B, bone morphogenetic protein receptor type-1B, bone morphogenetic protein receptor, type IB, CDw293 antigen, EC 2.7.11, EC 2.7.11.30, serine/threonine receptor kinase |
| Gene ID (Entrez) | 658 |
| Formulation | PBS |
| Classification | Polyclonal |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human BMPR-IB/ALK-6, Lys14-Arg126, Accession # O00238 |
| Primary or Secondary | Primary |
BMPR-IB/ALK-6 Antibody [HRP], Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Goat Polyclonal Antibody
| Content And Storage | Store at 4°C in the dark. |
|---|---|
| Target Species | Human |
| Host Species | Goat |
| Conjugate | HRP |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Mesenchymal Stem Cell Markers, Protein Kinase, Stem Cell Markers |
| Antigen | BMPR-IB/ALK-6 |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity-purified |
| Gene Alias | activin receptor-like kinase 6, ALK-6, ALK6CDw293, BMP type-1B receptor, BMPR-1B, bone morphogenetic protein receptor type-1B, bone morphogenetic protein receptor, type IB, CDw293 antigen, EC 2.7.11, EC 2.7.11.30, serine/threonine receptor kinase |
| Gene ID (Entrez) | 658 |
| Formulation | PBS |
| Classification | Polyclonal |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human BMPR-IB/ALK-6, Lys14-Arg126, Accession # O00238 |
| Primary or Secondary | Primary |
BMPR-IB/ALK-6 Antibody [Allophycocyanin], Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Goat Polyclonal Antibody
| Content And Storage | Store at 4°C in the dark. |
|---|---|
| Target Species | Human |
| Host Species | Goat |
| Conjugate | APC |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Mesenchymal Stem Cell Markers, Protein Kinase, Stem Cell Markers |
| Antigen | BMPR-IB/ALK-6 |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity-purified |
| Gene Alias | activin receptor-like kinase 6, ALK-6, ALK6CDw293, BMP type-1B receptor, BMPR-1B, bone morphogenetic protein receptor type-1B, bone morphogenetic protein receptor, type IB, CDw293 antigen, EC 2.7.11, EC 2.7.11.30, serine/threonine receptor kinase |
| Gene ID (Entrez) | 658 |
| Formulation | PBS |
| Classification | Polyclonal |
| Immunogen | Mouse myeloma cell line NS0-derived recombinant human BMPR-IB/ALK-6, Lys14-Arg126, Accession # O00238 |
| Primary or Secondary | Primary |