All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (922)
- (1,915)
- (4,393)
- (1)
- (1)
- (3)
- (1)
- (1,241)
- (1,734)
- (818,590)
- (21,502)
- (2)
- (764)
- (61)
- (1)
- (29)
- (1)
- (5,301)
- (3,354)
- (1,850)
- (218)
- (1)
- (8,787)
- (11,948)
- (2,269)
- (4)
- (1)
- (13)
- (67)
- (5)
- (7)
- (2,891)
- (3,877)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,433)
- (464)
- (1)
- (1)
- (136)
- (236)
- (3)
- (1)
- (3)
- (14)
- (96)
- (165,768)
- (202,750)
- (1)
- (22)
- (798)
- (2)
- (11,004)
- (1)
- (126)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (5)
- (1)
- (1)
- (10,773)
- (587)
- (1)
- (2)
- (1)
- (8)
- (2)
- (2)
- (321)
- (360)
- (5)
- (13,603)
- (2)
- (4,012)
- (2,250)
- (1)
- (14)
- (9)
- (1)
- (7)
- (5,604)
- (3,961)
- (1)
- (18)
- (1)
- (1)
- (2)
- (17,464)
- (16,743)
- (25)
- (1)
- (1)
- (2)
- (5,492)
- (2)
- (1)
- (32)
- (4)
- (13)
- (76)
- (578)
- (17)
- (2)
- (3)
- (1)
- (1)
- (1)
- (2,083)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,872)
- (2)
- (20)
- (3)
- (108)
- (1)
- (5)
- (1)
- (1)
- (5)
- (193)
- (2)
- (4,819)
- (11)
- (2)
- (5)
- (9)
- (4)
- (5)
- (23)
- (110)
- (7,532)
- (35,317)
- (1,381)
- (53)
- (1,544)
- (1)
- (21)
- (7)
- (1)
- (2,047)
- (1)
- (4,315)
- (41)
- (2)
- (1)
- (1)
- (4)
- (37)
- (1)
- (1)
- (755)
- (1)
- (1)
- (2)
- (4)
- (6)
- (3)
- (6)
- (1)
- (1)
- (81)
- (105)
- (719,742)
- (5)
- (5)
- (684,849)
- (31,084)
- (55)
- (547)
- (3)
- (564)
- (2,635)
- (38)
- (1)
- (15)
- (1,626)
- (726)
- (2)
- (2)
- (6)
- (4)
- (5)
- (93,727)
- (62)
- (115)
- (1,913)
- (15,528)
- (187)
- (8)
- (23)
- (519,821)
- (12)
- (1)
- (688,353)
- (72,677)
- (3)
- (38,005)
- (169)
- (1)
- (1)
- (29,471)
- (9)
- (1)
- (25)
- (2,849)
- (74)
- (89)
- (275)
- (2)
- (50)
- (29,574)
- (29,299)
- (6)
- (30,509)
- (16)
- (29,386)
- (45)
- (93)
- (48)
- (29,631)
- (1)
- (30,412)
- (1)
- (3)
- (1)
- (73)
- (29,785)
- (29,576)
- (145)
- (120)
- (36)
- (173)
- (23)
- (125)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (33,900)
- (11)
- (3)
- (223)
- (764)
- (1,057)
- (715)
- (767)
- (909)
- (879)
- (1,007)
- (844)
- (1,482)
- (911)
- (830)
- (1,049)
- (1,049)
- (1,050)
- (675)
- (1,080)
- (30,364)
- (99)
- (14)
- (47)
- (18)
- (1)
- (147)
- (1)
- (175)
- (3)
- (122)
- (28,377)
- (28,429)
- (28,720)
- (63)
- (28,433)
- (24,929)
- (1)
- (60)
- (28,366)
- (28,013)
- (27,994)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (32,471)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (29,378)
- (1)
- (30,807)
- (26,604)
- (17,685)
- (17,678)
- (26,587)
- (30,810)
- (38)
- (1)
- (46)
- (9)
- (13)
- (2)
- (103)
- (11)
- (22)
- (58)
- (26)
- (132)
- (171)
- (25)
- (90)
- (58)
- (14)
- (56)
- (73)
- (9)
- (78)
- (83)
- (99)
- (88)
- (90)
- (16)
- (64)
- (66)
- (42)
- (58)
- (50)
- (53)
- (108)
- (134)
- (41)
- (68)
- (65)
- (88)
- (73)
- (454)
- (30,837)
- (7)
- (4)
- (312)
- (387)
- (2,757)
- (3,690)
- (2)
- (3)
- (36)
- (214)
- (2,653)
- (94)
- (31)
- (27,071)
- (514)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (868)
- (144)
- (795)
- (824)
- (414)
- (340)
- (803)
- (35)
- (712)
- (2)
- (716)
- (780)
- (743)
- (778)
- (629)
- (763)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (12)
- (5)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (473,756)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,503)
- (29,535)
- (29,488)
- (2)
- (29)
- (23)
- (164)
- (829)
- (3)
- (2)
- (394)
- (94)
- (2)
- (1,075)
- (2)
- (3)
- (81)
- (5)
- (37)
- (131)
- (51)
- (281)
- (1)
- (5)
- (6,758)
- (5,480)
- (2)
- (1)
- (27)
- (4)
- (2)
- (63)
- (178)
- (1)
- (26)
- (2)
- (8,897)
- (43)
- (417)
- (173)
- (818)
- (157)
- (6)
- (348)
- (2)
- (42)
- (13)
- (3)
- (27)
- (56)
- (4)
- (1)
- (594)
- (55)
- (6)
- (21)
- (89,791)
- (2)
- (2)
- (57)
- (79)
- (251)
- (6)
- (258)
- (3,751)
- (6)
- (2)
- (1,793)
- (6)
- (38)
- (382,028)
- (8)
- (15,929)
- (14,549)
- (648)
- (224)
- (30)
- (35)
- (10,155)
- (92)
- (17)
- (17)
- (25)
- (934)
- (3)
- (2)
- (9)
- (11)
- (2)
- (2)
- (44)
- (6)
- (2)
- (290,402)
- (2,383)
- (17,790)
- (63)
- (36)
- (11)
- (1)
- (1)
- (4)
- (156)
- (2)
- (16,231)
- (61)
- (2)
- (1)
- (2)
- (157)
- (831)
- (12,433)
- (3)
- (137)
- (30)
- (2)
- (2)
- (10)
- (681)
- (3)
- (2)
- (2)
- (10)
- (70)
- (64)
- (3)
- (318)
- (1,573)
- (2,669)
- (208,002)
- (143,242)
- (191)
- (46)
- (144,827)
- (446,487)
- (77)
- (1,326)
- (33,769)
- (11)
- (213)
- (12,808)
- (430,644)
- (168)
- (504)
- (3)
- (551)
- (4)
- (158,208)
- (2,213)
- (26)
- (11)
- (51)
- (370)
- (22)
- (266)
- (1,076)
- (1,053)
- (1)
- (1,292)
- (2)
- (26)
- (6,381)
- (1)
- (786)
- (32)
- (9)
- (289)
- (3)
- (4)
- (2)
- (6)
- (21)
- (349)
- (2)
- (16)
- (1,594)
- (1)
- (2)
- (1,130)
- (199)
- (198)
- (33)
- (6)
- (35,010)
- (6)
- (1)
- (867)
- (81)
- (978)
- (1,894)
- (2)
- (3)
- (2)
- (14,395)
- (2)
- (1)
- (2)
- (1,257)
- (4)
- (132)
- (2)
- (1)
- (2,506)
- (105)
- (7)
- (21)
- (1,469)
- (1)
- (2,638)
- (4,208)
- (3,209)
- (41)
- (2)
- (2,392)
- (2)
- (460)
- (431)
- (2)
- (27)
- (14)
- (46)
- (14)
- (2,482)
- (217)
- (1)
- (1)
- (1)
- (29)
- (9)
- (39)
- (2)
- (1)
- (3)
- (1)
- (929,313)
- (3)
- (7,904)
- (19)
- (1)
- (22)
- (4)
Filtered Search Results
Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Canine,Rabbit,Hamster,Chicken,Yeast,Bacteria,Insect |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O14556, P00356, P04406, P04797, P16858, P17244, P46406, Q28259, Q64467, Q9ESV6 |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | GAPDH Loading Control |
| Gene Symbols | GAPDH, GAPDHS |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 38 kDa BFA-dependent ADP-ribosylation substrate; aging-associated gene 9 protein; BARS-38; bb02e05; cb350; cb609; CDABP0047; EC 1.2.1.12; epididymis secretory protein Li 278; epididymis secretory sperm binding protein Li 162eP; fb71f08; fk58c09; G3PD; G3PDH; GAPA; GAPA-1; GAPC; GAPC1; GAPC-1; GAPCp1; GAPCP-1; GAPD; GAPD2; gapdh; GAPDH2; GAPDH-2; GAPDH-A; GAPDHS; Gapds; Gapd-s; glceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase, testis-specific; glyceraldehyde phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase (G3PDH); glyceraldehyde-3-phosphate dehydrogenase 2; glyceraldehyde-3-phosphate dehydrogenase GAPDH; glyceraldehyde-3-phosphate dehydrogenase like-17 protein; glyceraldehyde-3-phosphate dehydrogenase type 2; glyceraldehyde-3-phosphate dehydrogenase, spermatogenic; glyceraldehyde-3-phosphate dehydrogenase, testis-specific; glyceraldehyde-phosphate-dehydrogenase; glycerine aldehyde 3-phosphate dehydrogenase; HEL-S-162eP; HEL-S-278; HGNC:4141; HSD35; HSD-35; I79_001391; KNC-NDS6; LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase, testis-specific; mg:bb02e05; MGC128279 protein; MGC88685; multifunctional protein, glycolytic enzyme; OK/SW-cl.12; Peptidyl-cysteine S-nitrosylase GAPDH; similar to glyceraldehyde 3-phosphate dehydrogenase; spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2; Spermatogenic glyceraldehyde-3-phosphate dehydrogenase; Unknown (protein for IMAGE:8101613); unnamed protein product; wu:fb33a10; wu:fb71f08; wu:fk58c09; wu:ft80f05; zgc:76908 |
| Gene | GAPDHS |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009074, 100352213, 100736557, 100767862, 14433, 14447, 24383, 2597, 26330, 374193, 403755, 476483, 66020 |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | Recombinant GAPDH. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | GA1R |
Invitrogen™ GAPDH Monoclonal Antibody (6C5)
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Maintain refrigerated at 2-8°C for up to 1 month. For long term storage store at -20°C |
|---|---|
| Target Species | Amphibian,Canine,Chicken,Fish,Human,Mouse,Monkey,Rabbit,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O14556, P00356, P04406, P04797, P16858, P46406, Q28259, Q64467, Q9ESV6 |
| Isotype | IgG1 |
| Antigen | GAPDH |
| Gene Symbols | GAPDH, GAPDHS |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 38 kDa BFA-dependent ADP-ribosylation substrate; aging-associated gene 9 protein; BARS-38; bb02e05; cb350; cb609; CDABP0047; EC 1.2.1.12; epididymis secretory protein Li 278; epididymis secretory sperm binding protein Li 162eP; fb71f08; fk58c09; G3PD; G3PDH; GAPA; GAPA-1; GAPC; GAPC1; GAPC-1; GAPCp1; GAPCP-1; GAPD; GAPD2; gapdh; GAPDH2; GAPDH-2; GAPDH-A; GAPDHS; Gapds; Gapd-s; glceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase, testis-specific; glyceraldehyde phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase (G3PDH); glyceraldehyde-3-phosphate dehydrogenase 2; glyceraldehyde-3-phosphate dehydrogenase GAPDH; glyceraldehyde-3-phosphate dehydrogenase like-17 protein; glyceraldehyde-3-phosphate dehydrogenase type 2; glyceraldehyde-3-phosphate dehydrogenase, spermatogenic; glyceraldehyde-3-phosphate dehydrogenase, testis-specific; glyceraldehyde-phosphate-dehydrogenase; glycerine aldehyde 3-phosphate dehydrogenase; HEL-S-162eP; HEL-S-278; HGNC:4141; HSD35; HSD-35; I79_001391; KNC-NDS6; LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase, testis-specific; mg:bb02e05; MGC128279 protein; MGC88685; multifunctional protein, glycolytic enzyme; OK/SW-cl.12; Peptidyl-cysteine S-nitrosylase GAPDH; similar to glyceraldehyde 3-phosphate dehydrogenase; spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2; Spermatogenic glyceraldehyde-3-phosphate dehydrogenase; Unknown (protein for IMAGE:8101613); unnamed protein product; wu:fb33a10; wu:fb71f08; wu:fk58c09; wu:ft80f05; zgc:76908 |
| Gene | GAPDHS |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009074, 100352213, 14433, 14447, 24383, 2597, 26330, 374193, 403755, 476483, 66020 |
| Formulation | PBS with 0.1% sodium azide; pH 7.4 |
| Immunogen | Purified rabbit muscle GAPDH (whole molecule). |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 6C5 |
Invitrogen™ CD45RA Monoclonal Antibody (HI100), eFluor™ 506, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | eFluor 506 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P08575 |
| Isotype | IgG2b κ |
| Concentration | 5 μL/Test |
| Antigen | CD45RA |
| Gene Symbols | PTPRC |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | B220; CD45; CD45 antigen; CD45 antigen isoform 1 precursor; CD45 antigen isoform 2 precursor; CD45 antigen isoform 3 precursor; CD45 antigen isoform 4 precursor; CD45 antigen isoform 5 precursor; CD45 antigen isoform 6 precursor; CD45R; GP180; LCA; L-CA; leucocyte common antigen; Leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; LOW QUALITY PROTEIN: receptor-type tyrosine-protein phosphatase C; LY5; Ly-5; Lyt-4; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; protein tyrosine phosphatase; alternatively spliced; PTPRC; Receptor-type tyrosine-protein phosphatase C; RT7; T100; T200; T200 glycoprotein; T200 leukocyte common antigen |
| Gene | PTPRC |
| Product Type | Antibody |
| Gene ID (Entrez) | 5788 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HI100 |
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
Invitrogen™ C1q Monoclonal Antibody (JL-1), Biotin
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | ELISA,Functional Assay,Immunohistochemistry (Frozen),Western Blot |
| Form | Liquid |
| Gene Accession No. | P02745, P02746, P02747, P14106, P31720, P31721, P31722, P98086, Q02105 |
| Isotype | IgG2b |
| Concentration | 0.1 mg/mL |
| Antigen | C1q |
| Gene Symbols | C1QA, C1QB, C1qc |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | AI255395; AI385742; C1q; C1qa; C1qb; C1qc; C1Q-C; C1QG; Ciqc; complement C1q A chain; complement C1q B chain; complement C1q C chain; complement C1q chain A; complement C1q chain B; complement C1q subcomponent subunit A; complement C1q subcomponent subunit A-like protein; Complement C1q subcomponent subunit B; Complement C1q subcomponent subunit C; complement component 1, q subcomponent, A chain; complement component 1, q subcomponent, alpha polypeptide; complement component 1, q subcomponent, B chain; complement component 1, q subcomponent, beta polypeptide; complement component 1, q subcomponent, C chain; complement component 1, q subcomponent, c polypeptide; complement component 1, q subcomponent, gamma polypeptide; complement component C1q, A chain; complement component C1q, B chain; complement subcomponent C1q chain B |
| Gene | C1QA |
| Product Type | Antibody |
| Gene ID (Entrez) | 12259, 12260, 12262, 29687, 298566, 362634, 712, 713, 714 |
| Formulation | PBS with 0.1% BSA and 0.02% sodium azide |
| Immunogen | Purified mouse C1q. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | JL-1 |
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), HRP
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | HRP |
| Applications | Western Blot |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with proprietary stabilizer and 0.07% Kathon; pH 7.2 |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
Human/Mouse Brachyury Antibody, R&D Systems™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody has been used in 94 publications
CD11c Monoclonal Antibody (N418), Alexa Fluor™ 532, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Armenian Hamster Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Armenian Hamster |
| Conjugate | Alexa Fluor 532 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | Q9QXH4 |
| Concentration | 0.2 mg/mL |
| Antigen | CD11c |
| Gene Symbols | Itgax |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6 |
| Gene | Itgax |
| Product Type | Antibody |
| Gene ID (Entrez) | 16411 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | N418 |
Invitrogen™ DLL3 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA2046)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Cynomolgus Monkey |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | Q9NYJ7 |
| Isotype | VHH |
| Concentration | 4.21 mg/mL |
| Antigen | DLL3 VHH-8His-Cys-tag |
| Gene Symbols | Dll3 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | delta like canonical Notch ligand 3; Delta3; delta-like 3; delta-like 3 (Drosophila); delta-like protein 3; Dll3; Drosophila Delta homolog 3; M-Delta-3; pu; pudgy; SCDO1 |
| Gene | Dll3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 102115332, 10683 |
| Formulation | PBS with no preservative |
| Immunogen | Recombinant Human DLL3. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA2046 |
Invitrogen™ CDH17 VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody (SAA1325)
Alpaca Recombinant Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Alpaca |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Western Blot |
| Form | Liquid |
| Gene Accession No. | Q12864 |
| Isotype | VHH |
| Concentration | 1.25 mg/mL |
| Antigen | CDH17 VHH-8His-Cys-tag |
| Gene Symbols | Cdh17 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | BILL-cadherin; Cadherin; cadherin 17; cadherin 17, LI cadherin (liver-intestine); cadherin-16; cadherin-17; CDH16; CDH17; FLJ26931; HPT1; HPT-1; HPT-1 cadherin; HPT-1/LI; human intestinal peptide-associated transporter HPT-1; human peptide transporter 1; intestinal peptide-associated transporter HPT-1; LI cadherin; LI-cadherin; Liver-intestine cadherin; MGC138218; MGC142024; P130 |
| Gene | Cdh17 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1015 |
| Formulation | 16.7mM citrate, 0.94mM citric acid with 6.2% sucrose and no preservative; pH 6 |
| Immunogen | Recombinant Human CDH17/Cadherin-17. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SAA1325 |
Invitrogen™ CFTR Monoclonal Antibody (CF3)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P13569, P26361 |
| Isotype | IgM |
| Concentration | Conc. Not Determined |
| Antigen | CFTR |
| Gene Symbols | CFTR |
| Regulatory Status | RUO |
| Gene Alias | ABC35; Abcc7; ATP Binding Cassette Superfamily C Member 7 (ABCC7); ATP-binding cassette sub-family C member 7; ATP-binding cassette transporter sub-family C member 7; ATP-binding cassette, subfamily c, member 7; AW495489; cAMP-dependent chloride channel; CF; CFTR; CFTR/MRP; Channel conductance-controlling ATPase; cystic fibrosis transmembrane conductance regulator; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); cystic fibrosis transmembrane conductance regulator homolog; cystic fibrosis transmembrane conductance regulator homolog; ATP-binding cassette, subfamily c, member 7; dJ760C5.1; MRP7; RGD1561193; tcag7.78; TNR CFTR; TNR-CFTR |
| Gene | CFTR |
| Product Type | Antibody |
| Gene ID (Entrez) | 1080, 12638 |
| Formulation | Ascites with 0.05% sodium azide |
| Immunogen | Synthetic Peptide: G(103) R I I A S Y D P D N K E E R(117). |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | CF3 |
Invitrogen™ Phospho-Tau (Thr181) Monoclonal Antibody (AT270)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Gene Accession No. | P10636 |
| Isotype | IgG1 κ |
| Concentration | 0.2 mg/mL |
| Antigen | Phospho-Tau (Thr181) |
| Gene Symbols | MAPT |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AI413597; AW045860; DDPAC; FLJ31424; FTDP17; FTDP-17; G protein beta1/gamma2 subunit-interacting factor 1; map tau; Mapt; MAPTL; MGC138549; microtubule associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau, isoform 4; microtubules; MSTD; Mtapt; MTBT1; MTBT2; Neurofibrillary tangle protein; neurofibrillary tangles; Neuronal Marker; paired helical filament-tau; PHFtau; PHF-tau; PPND; PPP1R103; protein phosphatase 1, regulatory subunit 103; pTau; RNPTAU; Tau; Tau microtubule-associated protein; tau protein; Tau-4; Tau5; Unknown (protein for MGC:134287) |
| Gene | MAPT |
| Product Type | Antibody |
| Gene ID (Entrez) | 4137 |
| Formulation | PBS with no preservative |
| Immunogen | Partially purified human PHF-Tau. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | AT270 |
COX15 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | Q7KZN9-2 |
| Concentration | 1 mg/ml |
| Antigen | COX15 |
| Gene Symbols | COX15 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 |
| Molecular Weight of Antigen | 44 kDa |
| Gene Alias | COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5 |
| Gene ID (Entrez) | 1355 |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Classification | Polyclonal |
| Immunogen | Synthetic peptides corresponding to COX15(COX15 homolog, cytochrome c oxidase assembly protein (yeast)) The peptide sequence was selected from the N terminal of COX15. Peptide sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY. |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Primary or Secondary | Primary |
| Test Specificity | Expected identity based on immunogen sequence: Yeast: 82%. |
YTHD1 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | Q9BYJ9 |
| Concentration | 0.5 mg/ml |
| Antigen | YTHD1 |
| Gene Symbols | YTHDF1 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1.0 ug/ml |
| Molecular Weight of Antigen | 61 kDa |
| Gene Alias | C20orf21, DACA-1, Dermatomyositis associated with cancer putative autoantigen 1, FLJ20391, YTH domain family 1, YTH domain family protein 1, YTH domain family, member 1 |
| Gene ID (Entrez) | 54915 |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Classification | Polyclonal |
| Immunogen | Synthetic peptides corresponding to YTHDF1(YTH domain family, member 1) The peptide sequence was selected from the middle region of YTHDF1. Peptide sequence QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA. |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Primary or Secondary | Primary |
| Test Specificity | Yeast: 83%. |