Rat Secondary Antibodies
American Research Products Inc VivoGenie AntiHuman EGFR
VivoGenie Anti-Human EGFR (Panitumumab) Biosimilar is a vivogenie with human reactivity Available in 100mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
American Research Products Inc AntiHuman TIGIT
Anti-Human TIGIT [4E1 2] In Vivo Antibody - Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
American Research Products Inc AntiMouse CD90
Anti-Mouse CD90 (Thy-1) [T24/31] In Vivo Antibody - Low Endotoxin is a in vivo antibody with mouse reactivity produced in rat Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
Miltenyi Biotec, Inc. CD90 Antibody, anti-human, Vio Bright B515, REAfinity™
Identification and enumeration of CD90+ cells by flow cytometry.
This product is subject to the following: Miltenyi Biotec, Inc. Terms and Conditions of Sale For Products and Services
Miltenyi Biotec, Inc. M aKi-67-APC, h, m, r, REA1123, 200ul
Recombinant antibody for the detection of Ki-67+ cells.
This product is subject to the following: Miltenyi Biotec, Inc. Terms and Conditions of Sale For Products and Services
CPC Scientific H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys10 and 26 bridge)MOLECULAR FORMULA: C146H239N47O44S3MOLECULAR WEIGHT:3453STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [133448-20-1], RESEARCH AREA: CardiovascularREFERENCES: M. Kojima et al., BBRC, 159, 1420 (1989)
Cytek Biosciences Inc PE Rt IgG2b Iso Con Anti Isoty
Product Name: PE Rat IgG2b Isotype Control (LTF-2)
Product Class: Antibody
Type: Isotype Control
Product Name: PE Rat IgG2b Isotype Control (LTF-2)
Cytek Catalog Number: 50-4031-U100
Marker: Isotype Control
Clonality: Monoclonal
Clone: LTF-2
Host Species: Rat
Isotype: IgG2b
Conjugation: PE
Size: 100 μg
Miltenyi Biotec, Inc. REAlease CD158b2-APC (REAL145) Kit, h
Identification and enumeration of CD158b2 (KIR2DL3)+ cells by flow cytometry.
This product is subject to the following: Miltenyi Biotec, Inc. Terms and Conditions of Sale For Products and Services
Miltenyi Biotec, Inc. aVEGFR-1 (Flt-1)-APC, h, REA569, 30 t
Identification and enumeration of VEGFR-1 (Flt-1)+ cells by flow cytometry.
This product is subject to the following: Miltenyi Biotec, Inc. Terms and Conditions of Sale For Products and Services
Miltenyi Biotec, Inc. CD337 (NKp30)-APC, h, AF29-4D12, 30 t
Detection of the natural cytotoxicity receptor (NCR) NKp30 on human NK cells, detection of CD337 (NKp30) on non-human primate cells.
This product is subject to the following: Miltenyi Biotec, Inc. Terms and Conditions of Sale For Products and Services
Cayman Chemical ICR-1potasIum salt 0.5mg
A cell-impermeable fluorescent calcium indicator; binds to calcium (Kd = 480 mM); ex/em = 580/660 nm, respectively; can be used in lipid membrane-free systems or liposomes or can be introduced into cells by electroporation, microinjection, or other methods
Miltenyi Biotec, Inc. M aCytokeratin 5/6-APC, h, REA913, 200ul
Recombinant antibody for the detection of Cytokeratin 5/6+ cells.
This product is subject to the following: Miltenyi Biotec, Inc. Terms and Conditions of Sale For Products and Services
Cell Biologics Rat Primary Dermal Microvascular Endothelial Cells
Rat Primary Dermal Microvascular Endothelial Cells