Cell Culture Media, Supplements, and Reagents
Apexbio Technology LLC RECOM. HUM. LR3 IGF-1 M.G 1MG
RECOM. HUM. LR3 IGF-1 M.G 1MG APEXBIO TECHNOLOGIES
Apexbio Technology LLC Kif15-IN-1(Synonyms: Kif15 inhibitor 1, Kif15-IN1, Kif15 inhibitor I, KIF15-IN-1, Kif15 motor protein inhibitor), 2mg, CAS: 672926-32-8.
Kif15-IN-1 (CAS 672926-32-8) is a small molecule inhibitor targeting kinesin family member 15 (Kif15) also termed kinesin-12 or HKLP2 Kif15 is a kinesin-related motor protein expressed during mitosis crucially involved in the formation and stabilization of bipolar microtubule spindles acting redundantly with KIF11 (Eg5) Inhibition of Kif15 by Kif15-IN-1 results in suppression of tumor cell proliferation highlighting its utility in cell biology research focused on mitotic spindle mechanics and its potential in oncology as a candidate for antiproliferative strategies
Cayman Chemical AsIaloglycoproteIn RECPTR 1
A σ1 receptor agonist inhibits reductions in mitochondrial oxygen consumption and lipid peroxidation induced by AB (25-35) in isolated mouse hippocampus at 1 mg/kg improves deficits in novel object recognition induced by AB (25-35) in mice as well as reduces tau phosphorylation and AB (1-42) levels in the hippocampus in the same model at 1 mg/kg increases the latency to fall in the rotarod test reduces gait impairments and reduces increases in the mean acoustic startle response in an Mecp2-/- mouse model of Rett syndrome at 30 mg/kg per day
![eMolecules 103408-45-3 | Pyrimido[1,2-a]purin-10(1H)-one | MFCD03413766 | 250mg](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502175564.JPG-250.jpg)
eMolecules 103408-45-3 | Pyrimido[1,2-a]purin-10(1H)-one | MFCD03413766 | 250mg
ChemScene | 5-Bromo-4-chloropicolinic acid | 100mg | 569148190 | CS-W018684 | 1060802-25-6 | MFCD13189053 | 236.450 | C6H3BrClNO2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
eMolecules 1005883-72-6 | Medchem Express | Z433927330 | 5mg | 482204282 | HY-126074 | 364.405 | C20H20N4O3
Ambeed | (3aR5R6S7R7aR)-2-(Ethylamino)-5-(hydroxymethyl)-5677a-tetrahydro-3aH-pyrano[32-d]thiazole-67-diol | 1mg | 534567940 | A333018 | 1009816-48-1 | MFCD15144964 | 248.300 | C9H16N2O4S
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
eMolecules 2632259-92-6 | Medchem Express | ZW4864 (free base) | 5mg | 705860638 | HY-132300A | 570.738 | C33H42N6O3
Ambeed | N-Benzylformamide | 5g | 599119339 | A401952 | 6343-54-0 | MFCD00003281 | 135.166 | C8H9NO
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
eMolecules 374559-48-5 | Medchem Express | Istaroxime (hydrochloride) | 5mg | 446266427 | HY-15718A | MFCD26960953 | 396.96 | C21H33ClN2O3
Ambeed | 2-Chloro-6-methylaniline | 5g | 490547843 | A273583 | 87-63-8 | MFCD00007679 | 141.600 | C7H8ClN
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
![Accela Chembio Inc (2s | 4r)-n-{(1s)-2-hydroxy-1-[(2s | 3r | 4s | 5r | 6r)-3 | 4 | 5-trihydroxy-6-(methylthio)-tetrahydro-2h-2-pyranyl]propyl}-1-methyl-4-propylpyrrolidine-2-carboxamide Hydrochloride | 5g | 859-18-7 | MFCD00083647 | 95+% | Shelf Life: 1980 Days | +4/n2](https://assets.fishersci.com/TFS-Assets/CCG/product-images/VN00116475-SY006929-5G.PNG-250.jpg)
Accela Chembio Inc (2s | 4r)-n-{(1s)-2-hydroxy-1-[(2s | 3r | 4s | 5r | 6r)-3 | 4 | 5-trihydroxy-6-(methylthio)-tetrahydro-2h-2-pyranyl]propyl}-1-methyl-4-propylpyrrolidine-2-carboxamide Hydrochloride | 5g | 859-18-7 | MFCD00083647 | 95+% | Shelf Life: 1980 Days | +4/n2
(2s | 4r)-n-{(1s)-2-hydroxy-1-[(2s | 3r | 4s | 5r | 6r)-3 | 4 | 5-trihydroxy-6-(methylthio)-tetrahydro-2h-2-pyranyl]propyl}-1-methyl-4-propylpyrrolidine-2-carboxamide Hydrochloride | 5g | 859-18-7 | MFCD00083647 | 95+% | Shelf Life: 1980 Days | +4/n2
Amsbio LLC Fibronectin (Type III CS-5) MAPTrix™-F, REDV containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (Type III CS-5) MAPTrix™-F REDV containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC Fibronectin (IIICS-1) MAPTrix™-F, IDAPS containing 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (IIICS-1) MAPTrix™-F IDAPS containing 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
Amsbio LLC Fibronectin (III-13) MAPTrix™-F, VSPPRRARVTDATETTITISWRTKTETITGFG 10.0 mg protein in solution, (conc. = 1mg/mL; aqueous) 10mL per vial
Fibronectin (III-13) MAPTrix™-F VSPPRRARVTDATETTITISWRTKTETITGFG 10.0 mg protein in solution (conc. = 1mg/mL; aqueous) 10mL per vial
Amsbio LLC Fibronectin (FN-C/H-I) MAPTrix™-F, YEKPGSPPREVVPRPRPGV 2.5 mg protein in solution, (conc. = 0.5mg/mL; aqueous), 5mL per vial
Fibronectin (FN-C/H-I) MAPTrix™-F YEKPGSPPREVVPRPRPGV 2.5 mg protein in solution (conc. = 0.5mg/mL; aqueous) 5mL per vial
MOLTOX Molecular Toxicology Inc Mitomycin C, 20 ug/vial, 5 vials/pack, Store in Refrigerator
For use in Ames test with TA102 tester strain. Dose 0.5 µg/plate. Reconstitute with organic solvents such as DMSO or sterile dH2O as applicable. Direct acting mutagens do not require the use of S9 metabolic activation to cause mutagenicity. CONTROLCHEM™ chemicals are obtained from major suppliers of research chemicals and are employed without further characterization or purification. Packaged quantities are precise within 1%. Please Note: CONTROLCHEM™ chemicals are known mutagens/carcinogens/toxins and are sold only to those experienced in the safe handling and disposal of hazardous materials. Consult your Institutional Safety Officer before ordering.