Novus Biologicals™ 53BP2 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP258677PEP

Catalog No. NBP258677PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 53BP2. Source: E.coli Amino Acid Sequence: TISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLE The 53BP2 Recombinant Protein Antigen is derived from E. coli. The 53BP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 7159
• Common Name: 53BP2 Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: apoptosis-stimulating protein of p53, 2, ASPP2P53BP2,53BP2apoptosis-stimulating of p53 protein 2, Bbp, Bcl2-binding protein, p53-binding protein 2, p53BP2, PPP1R13A, Renal carcinoma antigen NY-REN-51, tumor protein p53 binding protein, 2, tumor protein p5
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: TP53BP2
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50172. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.