Novus Biologicals
Browse a range of Novus Biologicals antibodies, proteins, stains, kits, research reagents, and other products to support your scientific needs.
Filtered Search Results

Collagen I Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 195 publications
Novus Biologicals™ LPS from E. Coli, TLR4 ligand
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Applications: Functional
Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4°C. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Peptide Array |
Form | Purified |
Isotype | IgG2c κ |
Research Discipline | Cancer |
Concentration | 0.2 mg/mL |
Antigen | Kallikrein 5 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Immunohistochemistry-Paraffin 1 to 2 μg/mL, Protein Array |
Gene Alias | EC 3.4.21, EC 3.4.21.4, kallikrein 5, Kallikrein-like protein 2, kallikrein-related peptidase 5, KLKL2, KLK-L2EC 3.4.21.-, SCTEkallikrein-5, Stratum corneum tryptic enzyme |
Gene ID (Entrez) | 25818 |
Formulation | 10 mM PBS with 0.05% BSA |
Immunogen | Recombinant fragment of human Kallikrein 5 protein (around aa 36-177) (exact sequence is proprietary) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | KLK5/3841 |
alpha-Synuclein Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 4 publications
Novus Biologicals™ Recombinant Human Peroxiredoxin 3 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified and high bioactivity. Generating reliable and reproducible results.
Novus Biologicals™ Glucose Assay Kit (Colorimetric)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Assay Kit (Colorimetric)
Novus Biologicals™ NF-L Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Laminin Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 72 publications
Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat,Chinese Hamster,Invertebrate,Mammalia,Rabbit,Sheep |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P19137 |
Research Discipline | Angiogenesis, Apoptosis, Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors |
Concentration | 1 mg/ml |
Antigen | Laminin |
Gene Symbols | LAMA1 |
Regulatory Status | RUO |
Purification Method | IgG purified |
Dilution | Western Blot 1:100 - 1:5000, Flow Cytometry, Immunohistochemistry 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:500 - 1:2000, Immunohistochemistry-Frozen 1:500 - 1:2000, Immunohistochemistry Free-Floating 1:1000 - 1:5000 |
Molecular Weight of Antigen | 337 kDa |
Gene Alias | LAMA, Laminin A chain, laminin subunit alpha-1, laminin, alpha 1, Laminin-1 subunit alpha, Laminin-3 subunit alpha, PTBHS, S-LAM alpha, S-laminin subunit alpha |
Gene ID (Entrez) | 284217 |
Formulation | 50% PBS, 50% Glycerol with 5mM Sodium Azide |
Immunogen | Laminin Antibody was made to Laminin 111 isolated from mouse Engelbreth-Holm-Swarm (EHS) sarcoma cells. [UniProt# P19137] |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Laminin Antibody is pan-specific and reacts well with all Laminin isoforms tested: Laminin-1 (alpha-1, beta-1, and gamma-1) and Laminin-2 (alpha-2, beta-1, and gamma-1). |
SCF/c-kit Ligand Rabbit anti-Human, Clone: 4, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Biologically Active Proteins, Cancer, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Stem Cell Markers |
Antigen | SCF/c-kit Ligand |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | ELISA 1:5000-1:10000, Sandwich ELISA Detection 1:1000-1:10000 |
Gene Alias | DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, KIT ligand, Kitl, KL-1, Mast cell growth factor, MGFSHEP7, SCFStem cell factor, SFc-Kit ligand, steel factor |
Gene ID (Entrez) | 4254 |
Formulation | 0.2 um filtered solution in PBS |
Immunogen | Recombinant Human SCF/c-kit Ligand protein |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 4 |
Recoverin Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence |
Form | Purified |
Isotype | IgG |
Research Discipline | Neuroscience, Vision |
Antigen | Recoverin |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gene Alias | cancer associated retinopathy antigen, Protein CAR, RCV1Cancer-associated retinopathy protein, recoverin |
Gene ID (Entrez) | 5957 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1).,, Sequence:, MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals™ Sheep Progesterone ELISA Kit (Colorimetric)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Sheep Progesterone ELISA Kit (Colorimetric) employs competitive ELISA technique for detection of Sheep Progesterone
Target | Progesterone |
---|---|
Product Type | ELISA Kit (Colorimetric) |
Sample Type | Plasma,Serum,Tissue Homogenates |
Sample Volume | 50 to 100 μL |
Synonym | Pregn 4 ene 3 20 dione |
Assay Sensitivity | 0.2ng/mL |
Assay Range | 0.4ng/mL to 30ng/mL |
Storage Requirements | Store at 4°C |
Research Discipline | Signal Transduction |
For Use With (Application) | ELISA |
Ly-6G/Ly-6C Antibody (RB6-8C5) - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rat Monoclonal Antibody
CD90/Thy1 Antibody (783922), PE, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
His Tag Antibody (HIS.H8), Alexa Fluor™ 647, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Store at 4C in the dark. |
---|---|
Target Species | Tag |
Host Species | Mouse |
Conjugate | Alexa Fluor 647 |
Applications | Western Blot,Western Blot,Flow Cytometry,ELISA,Immunocytochemistry |
Form | Purified |
Isotype | IgG2b |
Research Discipline | Cellular Markers, Epitope Tags |
Antigen | His Tag |
Regulatory Status | RUO |
Purification Method | Protein A or G purified |
Dilution | Western Blot, Simple Western, Flow Cytometry, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, CyTOF-ready |
Gene Alias | 6 His epitope tag, 6-His Tag, 6X His, 6X His Tag, 6X-His, 6x-His Tag, H, Hexa His tag, HHHHHH epitope tag, HHHHHH tag, HIS, His tag, His6-Tag, polyHistidine, Poly-histidine, polyhistidine tag |
Formulation | 50mM Sodium Borate |
Classification | Monoclonal |
Immunogen | This His Tag Antibody (HIS.H8) was developed against a 6x His synthetic peptide. |
Primary or Secondary | Primary |
Clone | HIS.H8 |
Novus Biologicals™ Triglyceride Assay Kit (Colorimetric)
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Assay Kit (Colorimetric)