Novus Biologicals™ A-RAF Recombinant Protein Antigen

Catalog No.	Quantity
NBP255054PE	100 μL

Catalog No. NBP255054PE Supplier Novus Biologicals™ Supplier No. NBP255054PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human A-RAF. Source: E.coli Amino Acid Sequence: DSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDS The A-RAF Recombinant Protein Antigen is derived from E. coli. The A-RAF Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 369
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: A-RAF Recombinant Protein Antigen
• Content And Storage: −20°C, avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: ARAF1A-RAF, EC 2.7.11, EC 2.7.11.1, Oncogene ARAF1, PKS, PKS2A-Raf proto-oncogene serine/threonine-protein kinase, Proto-oncogene A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene Pks, RAFA1, Ras-binding protein DA-Raf, serine/threonine-protein kinase A-Raf,
• Gene Symbol: ARAF
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50085. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.